KEGG   Burkholderia cepacia GG4: GEM_5847Help
Entry
GEM_5847          CDS       T02205                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bct  Burkholderia cepacia GG4
Pathway
bct00250  Alanine, aspartate and glutamate metabolism
bct00410  beta-Alanine metabolism
bct00640  Propanoate metabolism
bct00650  Butanoate metabolism
bct01100  Metabolic pathways
bct01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    GEM_5847
   00650 Butanoate metabolism
    GEM_5847
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GEM_5847
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GEM_5847
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bct01007]
    GEM_5847
Enzymes [BR:bct01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     GEM_5847
Amino acid related enzymes [BR:bct01007]
 Aminotransferase (transaminase)
  Class III
   GEM_5847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AFQ52231
UniProt: J7JM29
LinkDB All DBs
Position
2:complement(2939607..2940890)
Genome map
AA seq 427 aa AA seqDB search
MKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPK
IVKAISDQLNSFTHTAYQIVPYASYVELAEKINARAPGDFQKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNALHGVTTA
DSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFYAAPAEFVRALRKICNEHGILLIADEV
QTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADLMDAAAPGGLGGTYAGN
PLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNSLQADVPQIADVRGPGAMIAVEFLK
PGSGEPDAEFTKRVQTRALERGLLLLVCGVYSNVVRFLFPLTITQAVFDEALVILEEVLK
ETVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgacctgcaggcccgcaagaacgccgccaccccgcgcggcgtcggcgtg
atgtgcgatttctacgcagcccgcgccgagaacgcggaactgtgggatgtcgaaggccgc
cgcttcatcgatttcgccgccggcatcgcggtgctgaacacgggccaccgccacccgaag
atcgtcaaggcgatctcggaccaactgaacagcttcacgcacaccgcttaccagatcgtc
ccgtacgcgtcgtacgtcgagctggccgagaagatcaacgcccgcgcgccgggcgacttc
cagaagaagaccgcgttcttcacgaccggcgccgaagccgtcgaaaacgcgatcaagatc
gcccgcgccgcgaccggccgtccgggcgtcatcgcgttctcgggcggcttccacggccgc
acgatgatgggcatggcgctgaccggcaaggtcgcgccgtacaagctgaacttcggcccg
ttcccgggcgacgtgttccacgcgccgtacccgaacgcgctgcacggcgtgacgacggcc
gactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgaaccggtccagggcgaaggcggcttctatgcggcgccggcggaattc
gtgcgcgcgctgcgcaagatctgtaacgaacacggcatcctgctgatcgccgacgaagtc
cagacgggcttcgcgcgtaccggcaagctgttcgcgatgcagcactacgacgtgctggcc
gacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtcgtcggc
cgtgcggacctgatggacgcggcagcgccgggcggcctcggcggcacctacgcgggcaac
ccgctggccgtcgcgtcggcgcacgcggtgctcgagatcatcgacgaagagaagctgtgc
gagcgcgcgacgcaactcggcgacgtgctgaaggcgaagctgaattcgctgcaggccgac
gtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgagttcctgaaa
ccgggttcgggcgagccggacgcggaattcacgaagcgcgtgcagacgcgcgcactcgag
cgcggcctgctgctgctcgtctgcggcgtctactcgaacgtcgtgcgcttcctgttcccg
ctgacgatcacgcaggccgtgttcgacgaagcgctcgtgatcctcgaggaagtgctgaag
gaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system