KEGG   Bacillus cereus AH820: BCAH820_4708Help
Entry
BCAH820_4708      CDS       T00814                                 

Gene name
citC
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bcu  Bacillus cereus AH820
Pathway
bcu00020  Citrate cycle (TCA cycle)
bcu00480  Glutathione metabolism
bcu01100  Metabolic pathways
bcu01110  Biosynthesis of secondary metabolites
bcu01120  Microbial metabolism in diverse environments
bcu01130  Biosynthesis of antibiotics
bcu01200  Carbon metabolism
bcu01210  2-Oxocarboxylic acid metabolism
bcu01230  Biosynthesis of amino acids
Module
bcu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCAH820_4708 (citC)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BCAH820_4708 (citC)
Enzymes [BR:bcu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BCAH820_4708 (citC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACK88232
UniProt: B7JRW6
LinkDB All DBs
Position
complement(4461758..4463050)
Genome map
AA seq 430 aa AA seqDB search
MTTGEKITVTNGVMNVPNNPIIPFIEGDGIGPDIWAAASRVLEAAVEKAYDGEKKIVWKE
VLAGEKAFNQTGEWLPEETLNLIREYLIAIKGPLTTPVGGGIRSLNVALRQELDLYVCLR
PVRYFEGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAQGSPEAEKVLAFLKEAMGVNKIR
FPETSGIGIKPISEEGTKRLVRAAIQYAINEKRSSVTLVHKGNIMKFTEGAFKNWGYEVA
EQEFGDKVFTWAEYDRIVEKDGKDAANKAMADAEVAGKIIVKDSIADIFLQQILTRPREF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKYAGLDKVNPS
SVLLSGVLLLEHLGWNEAAKLVTASVEKTIASKVVTYDFARLMEGATEVKCSEFANELIK
NMDVAIIKNA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacaggtgaaaaaattactgtaactaatggtgttatgaatgtaccaaacaatccg
attattccatttatcgaaggagatggaattggtcctgatatttgggcagctgcatctcgt
gtactagaagcagcagttgaaaaagcttatgatggtgagaagaaaatcgtttggaaagaa
gtgcttgcaggggaaaaagcattcaaccaaacaggcgagtggttaccagaagaaacttta
aatttaattcgtgaatatttaatcgcgattaaaggtccacttacaactccagttggcggt
ggtattcgttctctaaacgtagcacttcgtcaagaattagatttatatgtatgtctacgt
ccagttcgttattttgaaggtgttccttcacctgtaaaacgtccggaagatactgatatg
gttattttccgtgaaaatacagaagacatttatgctggaattgaatatgcgcaaggatct
ccagaagcagaaaaagttcttgctttcttaaaagaagcaatgggtgttaataaaatccgc
ttcccagaaacatctggtattggtattaaaccaatctcagaagaagggacaaagcgtctt
gttcgtgctgcaattcaatatgcaattaacgaaaaacgctcttctgttacattagttcat
aaaggaaacattatgaaattcacagaaggtgctttcaaaaactggggttacgaagtagcg
gaacaagaattcggcgacaaagtatttacttgggctgaatatgatcgcatcgttgagaaa
gatggtaaagatgcagcgaataaagcgatggcagacgctgaagtggctggaaaaatcatc
gtaaaagattctattgcagacatcttcttacaacaaattttaactcgtccacgtgagttc
gatgttgttgcaacaatgaacttaaacggagactacatctctgatgcacttgctgcacaa
gtaggtggaattggtattgcacctggtgcaaacattaactatgtaactggacatgctatc
tttgaagctacgcacggtacagctccaaaatatgcaggtttagataaagtaaacccatct
tcagttcttctttctggtgtattattattagagcacttaggatggaacgaagctgcgaaa
ttagtaactgcttcagttgagaaaacaattgcttcaaaagtagtaacttatgatttcgca
cgcttaatggaaggtgcaacagaagtgaaatgttctgagttcgctaatgaacttattaaa
aacatggatgtagcgataatcaaaaacgcataa

DBGET integrated database retrieval system