KEGG   Bacillus cereus AH820: BCAH820_4763Help
Entry
BCAH820_4763      CDS       T00814                                 

Definition
(GenBank) putative acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcu  Bacillus cereus AH820
Pathway
bcu00010  Glycolysis / Gluconeogenesis
bcu00620  Pyruvate metabolism
bcu00630  Glyoxylate and dicarboxylate metabolism
bcu00640  Propanoate metabolism
bcu00680  Methane metabolism
bcu01100  Metabolic pathways
bcu01110  Biosynthesis of secondary metabolites
bcu01120  Microbial metabolism in diverse environments
bcu01130  Biosynthesis of antibiotics
bcu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAH820_4763
   00620 Pyruvate metabolism
    BCAH820_4763
   00630 Glyoxylate and dicarboxylate metabolism
    BCAH820_4763
   00640 Propanoate metabolism
    BCAH820_4763
  09102 Energy metabolism
   00680 Methane metabolism
    BCAH820_4763
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bcu01004]
    BCAH820_4763
Enzymes [BR:bcu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BCAH820_4763
Lipid biosynthesis proteins [BR:bcu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BCAH820_4763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACK91483
UniProt: B7JS21
LinkDB All DBs
Position
complement(4509822..4511408)
Genome map
AA seq 528 aa AA seqDB search
MKREELLAPPSYNLVSEIEKYTGDKEKLALIWQDDKGNRREVTYAELMKGANKIGNAFIK
SGLQKGDKLLIMMPRLIEAYMTYIAAIKAGFVVIPSSEMLRKKDIEYRIGHGEVKAIVSY
EPYIGQFDDIEAMESLQKFVLSEQSVDGWINLKTALETESDMLEMAKTDKEDMVFLSYTS
GTTGNPKGVVHTHAWAYAHLRTSAPNWLGIEENDVVWATASPGWQKWIWSPFLATLGSGA
TGFVYHGKFEPKTYLNLLDDNKVNVLCCTPTEYRLMAKVENLSEYNLEALHSAVSAGEPL
NREVIETFQKHFHITVRDGYGQTENTLLVGVMKGMDIRPGSMGKPTPGNHVDIVDEEGMP
VRVGEVGDIAVHIETPALFKQYYKDDERTAMQFRGDYYITGDKAKKDEDGYFWFEGRGDD
IIISSGYTIGPFEVEDALVKHPYVRECAVVASPDEIRGSVVKAFIVLRENIEKNEEILIP
ILQQHVKELTAPYKYPRKIEFVDELPKTISGKIRRIELRKQEMEIPSK
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagaggaattgttggcaccaccgtcttataatttagtttctgaaatagagaaa
tatacaggtgataaagagaagcttgctttaatttggcaagatgataaagggaatcgacga
gaagttacatacgctgagttaatgaaaggtgcaaataaaattggaaacgcttttataaag
agtggtctgcaaaaaggggacaagctcctcattatgatgccgcgtttaattgaagcgtac
atgacgtatatcgctgcgattaaagcaggatttgtcgtaattccgagttcggaaatgtta
cgcaaaaaggatatcgaatatcgcattggacacggggaagtaaaagcaatcgtaagttat
gagccttacattggacagtttgatgatatagaagcgatggaatcccttcaaaagttcgtt
ctgagcgagcagtcagtagatggatggatcaatttaaaaacagcgttagaaacagaaagt
gacatgttagaaatggcgaagacagataaagaagatatggtctttttatcttacacgtca
ggaacgacaggaaacccaaaaggtgttgttcatacgcatgcgtgggcatacgctcactta
cgtacgagcgctccgaattggctcggaattgaagagaatgatgttgtatgggcaacagct
agtccaggctggcagaagtggatttggagcccgtttttagcaactctaggctcgggggca
acaggatttgtataccacggtaagtttgaaccaaaaacgtatttaaatttattagacgat
aataaggtgaatgtgctttgttgtacgccaactgagtatagattaatggcaaaggtagag
aatttaagcgagtacaatttagaagcgttacatagcgctgtatccgcaggtgagccgtta
aatagagaagtcattgaaacgttccaaaagcactttcatattacagtgagagacggctat
gggcaaacggaaaacacattgcttgttggtgtaatgaaagggatggatattagaccagga
tcaatggggaaaccgacgccaggcaaccacgttgatattgtagatgaggaagggatgcca
gtaagggtaggcgaagttggtgatattgcggttcacattgaaacaccagccctctttaaa
caatactataaagacgatgagcgcacagcgatgcaattccgcggtgattattatattacc
ggtgataaagcgaagaaagatgaagacggctatttctggtttgaagggcgcggtgatgat
attattattagctctggttatacaatcgggccgtttgaagtagaagatgcgctcgtaaag
cacccttatgtaagagaatgtgcggttgtcgcaagccctgatgaaattcgcggaagtgtc
gtgaaggcatttatcgtattaagagagaatatagaaaagaacgaagaaatattaattcca
atactccaacaacacgtcaaggaacttactgcaccatataaataccctcgcaaaattgaa
tttgtagatgaactaccaaaaacgatttctggaaaaatccgccgtattgaacttagaaaa
caagagatggagattccgtcaaaataa

DBGET integrated database retrieval system