KEGG   Bacillus cereus AH820: BCAH820_5350Help
Entry
BCAH820_5350      CDS       T00814                                 

Definition
(GenBank) putative lipoprotein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
bcu  Bacillus cereus AH820
Pathway
bcu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bcu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BCAH820_5350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcu02000]
    BCAH820_5350
Transporters [BR:bcu02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    BCAH820_5350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_1 SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: ACK90505
UniProt: B7JGI4
LinkDB All DBs
Position
complement(5047550..5048584)
Genome map
AA seq 344 aa AA seqDB search
MRKIAFFFFLLVIGGAMSSCSRDTTSIKYNKSGLPILDDRHLVAYVAAREEVGEALLSSF
CKPRGCTYEFIRLSTEELLRRVEEEAGNPKADIIIGGTVDAHQMMKQKNLSIPVTSQHAN
RISKTVKDKDGYWYGYEVEKLAIAINKERWNEEIAPLGLPYPSRWQDLLNPVYKEKVVMP
DPNVSGTAYTFFQSLIDTVGEEEAKEYVKSFAGQVGEVTVNGYIPVELVASGEYMIGINF
MGDQRMLQKQGFPVVSIVPEQTGLSVNAISKLKRAPNGIIADLFIDYCLSEEAGHILEKV
SFGVPTMFAKNEKEIEGQPVRRTNQNISNSGIIEIWNRQRLSQK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagatagcctttttcttctttttgctagtaattggaggagcgatgtctagttgc
tctcgagatacgacctctattaaatataataaaagtggtctccctattttggatgatcgt
catcttgttgcgtatgtagcggctcgcgaggaagtgggggaagcgttgctttcatcattt
tgtaaaccacgcggctgtacgtatgagtttattcgtctttcgacagaagagcttcttcgg
agggtagaagaggaagctggaaatccgaaagcggatattattattggcggtacggtagat
gcgcatcaaatgatgaagcaaaaaaacctatctattcctgttacgagccagcatgcgaac
cgtatttcaaaaactgttaaagataaagatggttattggtacggttatgaagtagagaag
ctggcaattgcgatcaataaagagcggtggaacgaagaaatagcaccgctcggacttcct
tatccatcaaggtggcaagatttgttaaatccagtatataaggaaaaggttgttatgcca
gatccaaatgtttcaggaacagcatatacgttttttcaatcacttattgatactgtaggt
gaagaggaagcgaaagaatatgttaagagttttgcagggcaagttggtgaagtaacggtg
aatggttacataccagtagagcttgttgcgagcggtgagtatatgatcggcatcaatttc
atgggagatcaaagaatgcttcaaaaacaaggctttccagttgtaagtatcgtacctgag
caaacagggttatctgttaatgcgatttcgaaactaaaacgtgcaccgaatggtattatt
gcggatttatttattgattattgtttatcagaagaagcgggtcacattttagaaaaggtt
tcgtttggcgtgccaacgatgtttgcgaagaacgagaaagaaatagaaggacagccggtt
agaagaacaaaccaaaatatatcaaatagcggaataatcgagatatggaatagacaacgt
ctctctcagaagtga

DBGET integrated database retrieval system