KEGG   Beutenbergia cavernae: Bcav_0324Help
Entry
Bcav_0324         CDS       T00893                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
bcv  Beutenbergia cavernae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like
Motif
Other DBs
NCBI-ProteinID: ACQ78588
UniProt: C5BWD0
LinkDB All DBs
Position
349008..350198
Genome map
AA seq 396 aa AA seqDB search
MNSLGWLQLLASLPRAVKVLLVARFVNRIGAFSMPFLAVLLVQEVEASTVLAGTVMAAFG
VATIPSRLLGGVLAQRVATRHAVAVGLLGTAAAQGLIASASSVAMALVGAVLLGLFFEIY
EPASQALIADTTPDALLPRTYGLFGATLACAGLAAGTIAALVGQIGLRWLFVVDAATATA
CAALVIGLMPRSTRSTAPSATRTRSAWGDRRLWSLMLTGTAFATVYLTVPMAMPLALIDA
GHHPSVAGWLEALSALVVIAAQPLLSGRPAAARRMVVGYAAIAAGLATAAAAPTLAGYAA
ATLVMSVGDALLLGYSLTLVARIAPAGSTAAYFAAYGLTWGVALILGPPAMGYLIGIGPP
TFWSACAIVMVCTGAATAVIVRRLARATTRGRGGVG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtctcggctggcttcagctgctcgcgtccctgccacgcgcggtgaaggtcctg
ctggtggctcgcttcgtgaaccgcatcggtgccttctcgatgccgttcctggccgttctg
ctggttcaggaggtcgaggcgagcaccgtgctggcagggacggtgatggccgccttcggt
gtcgcgaccatcccgtcccgactcctcggaggcgtgctcgcgcagcgcgtcgctacacgc
cacgcggtggccgtcgggctgctcggcacggctgcggcccaggggctgatcgcgagcgcg
tcctccgtggcgatggcgctggtcggggccgtccttctcgggctgttcttcgagatctac
gaaccggcgagccaggcactcatcgcggacaccacaccagatgcgctgctgccacgaacc
tacggcctgttcggcgcaacgctcgcctgtgcgggacttgccgcggggacgatcgctgcc
ctcgtgggacagatcggcctgcggtggttgttcgtcgtcgacgccgccacggccacggcc
tgtgccgcactggtcatcgggttgatgccacggtcgacccgctctaccgcgccctcggcg
acgcggacgcgatccgcgtggggcgatcggcggctgtggtccctgatgctgacgggaacg
gccttcgcgacggtctacctgaccgtcccgatggcgatgcccttggcgttgatcgacgcg
gggcaccatccctcggtggccggatggctcgaggcgctgtccgcgctggtggtgatcgcg
gcgcaaccactcctgagcgggcgcccggcggctgctcgacgcatggtcgtcggctacgcc
gccatcgccgccgggctcgccacggcggccgccgcgcccacgctcgccgggtacgcggcc
gcgactctcgtcatgagcgtcggcgacgctctgttgctcggctacagcctcaccctggtg
gcgcggatcgccccagcgggatcgacggccgcctacttcgccgcgtacgggctcacctgg
ggtgtggccctcatcctcgggcctcccgccatgggctacctcatcggcatcggtccgccg
acgttctggtcggcgtgcgccatcgtcatggtctgcaccggagcggccacggcagtcatc
gttcgacgcctggctcgtgccacgacgagggggcgcggcggcgtcggctag

DBGET integrated database retrieval system