KEGG   Beutenbergia cavernae: Bcav_0480Help
Entry
Bcav_0480         CDS       T00893                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
bcv  Beutenbergia cavernae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ACQ78743
UniProt: C5BX68
LinkDB All DBs
Position
535733..536848
Genome map
AA seq 371 aa AA seqDB search
MALPLTSPIDPMLAKSVRGVPDADAVPGGYAYEPKWDGFRTIVFADDGDVELQSRNGKPM
TRYFPEIVDAVKAELPARCVVDGEVVLSRGGRLDFELLGQRIHPAASRVKMLAEHAPAAL
VVFDLLALGDDDLTQRPFAERAAALDELGLDGPSVHVTPRTRDADVAREWFTTYEGAGLD
GVVAKPLDGAYEPGKRAMLKIKHERTADVALAGYRLHKTSTDERPLIGSLLLGLFDDGGD
LRFVGVSASFPAARRAELYDELQELRVGEGDEHPWGNWQQPEGSRRPGAVSRWNAGKDLS
FTALRVERVLEVGYDHMEGDRFRHTAQFKRWRPDREPTSCTYAQLDEAVGYDLAELLPGA
PTAAPGFTGAL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggccctgccgctgacctcgccgatcgacccgatgctcgccaagtccgtgcgcggcgtt
cccgacgccgacgccgtccccggcgggtacgcgtacgagccgaagtgggacggcttccgc
acgatcgtgttcgccgacgacggcgacgtcgagctgcagagtcgcaacggcaagccgatg
acgcggtacttcccggagatcgtggacgccgtgaaggcggagctgccggcgcggtgcgtg
gtcgacggcgaggtcgtgctctcgcgcggcggacgcctcgacttcgagctcctcgggcag
cgcatccacccggcggcgtcgcgcgtgaagatgctcgcggagcacgcgccggccgcgctg
gtggtgttcgacctgctcgcgctcggcgacgacgacctcacccaacgcccgttcgcggag
cgcgcggccgccctcgacgagctcggcctcgacggcccgtccgtccacgtcacgccgcgc
acgcgcgacgccgacgtcgcccgcgagtggttcacgacgtacgagggggcggggctcgac
ggcgtcgtcgccaagccgctggacggcgcgtacgaacccgggaagcgcgcgatgctcaag
atcaagcacgagcgcacggccgacgtcgccctcgccgggtaccgcctccacaagacgtcg
accgacgagcggccgctcatcggttccctcctcctcggcctgttcgacgacggcggcgac
ctgcggttcgtgggcgtctcggcgtcgttcccggccgcccgccgggccgagctgtacgac
gagctgcaggagctgcgcgtgggcgagggggacgagcacccgtggggcaactggcagcag
cccgagggcagcaggcggcccggcgccgtgtcgcggtggaacgccgggaaggacctgtcg
ttcaccgcgctgcgcgtggagcgcgtgctcgaggtgggctacgaccacatggagggcgac
cggttccgccacacggcgcagttcaagcgctggcgcccggaccgggagccgacctcgtgc
acgtacgcacagctcgacgaggccgtgggctacgacctcgccgagctgctgcccggtgcc
ccgaccgcggcaccgggcttcaccggcgcgctctga

DBGET integrated database retrieval system