KEGG   Beutenbergia cavernae: Bcav_1547Help
Entry
Bcav_1547         CDS       T00893                                 

Definition
(GenBank) Glycerone kinase
  KO
K20901  L-erythrulose 1-kinase [EC:2.7.1.209]
Organism
bcv  Beutenbergia cavernae
Brite
KEGG Orthology (KO) [BR:bcv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bcav_1547
Enzymes [BR:bcv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.209  L-erythrulose 1-kinase
     Bcav_1547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak1 Dak2
Motif
Other DBs
NCBI-ProteinID: ACQ79803
UniProt: C5C3A4
LinkDB All DBs
Position
1775854..1777611
Genome map
AA seq 585 aa AA seqDB search
MTHLVNDPHSFASDVLDGFVAAHPDDVVRVHGGVVRATRTPQGQVAVVLGGGSGHYPAFA
GWVGPGMAHGAVCGNVFASPSASQAVSVVRAAQAGGGVLLGFGNYAGDVLQFGEAARELR
AAGIDVRIVTVTDDVASAPPERAEERRGIAGDLVVLKVAGAAAAAGYDLDDVERVTRMTN
DRTRTIGVALSGCTLPGQVEPLFAVEPGTIALGLGIHGEPGLAAHALGTAAQVADELVDR
LLAELPCDVGDRVAVLLNGLGSTTHEELFAVYGRVASRLCEAGLVAVRPEVGEHVTSLDM
AGLSLTLTLLDPELETLWLAPVDAPALRRGAPAPAATGERRDARDVDRPEEVAVAEGTPE
SRRAAAVALDALAAVCRALREAETELGALDAVAGDGDHGQGMVLGAAGALAAGRAAHDSG
AGLASVLRSCGAAWAEAAGGTSGALWGGALRAAADAFDDASAPDAAAVLVAVERAAEAVT
AAGGASVGDKTMVDAVVPFVEALRSALGDAAPAAAWSTAAAAADRAAAGTADLVARRGRA
RTHGERGIGHRDPGAVSFALVMTAAGRVRGADLVEAAADARATED
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacctggtcaacgacccccactccttcgcctccgacgtgctggacggcttcgtc
gccgcccaccccgacgacgtcgtgcgggtgcacggcggcgtcgtgcgagccacccgcaca
ccccaaggccaggtcgccgtcgtcctcgggggagggtccggccactacccggcgttcgcc
ggctgggtcgggcccggcatggcgcacggtgcggtgtgcggcaacgtgttcgcgtcgccg
tcggcgtcgcaggccgtctcggtggtccgcgcggcacaggccggcggcggggtgctgctg
ggcttcggcaactacgccggcgacgtgctgcagttcggcgaggccgcgcgggagcttcgg
gctgcggggatcgacgtgcggatcgtcacggtgacggacgacgtcgcgtcggcaccgccg
gagcgcgcggaagaacgccgcggcatcgccggcgacctcgtcgtcctcaaggttgccggc
gccgcggccgcggccgggtacgacctcgacgacgtcgagcgggtcacccggatgaccaac
gaccgcacgcgcacgatcggcgtggcgctgtccggctgcacgctgccggggcaggtcgag
ccgctgttcgccgtcgagcccggcacgatcgcgctggggttgggcatccacggggagccc
ggcctcgcggcgcacgccctcgggacggcggcccaggtggcggacgagctcgtggaccgg
ctgctcgcggagctgccgtgcgacgtcggcgaccgcgtggcggtgctgctcaacgggctc
ggctcgacgacccacgaggagctgttcgccgtctatgggcgcgtcgcgtcgcggctttgc
gaggcggggctcgtcgcggtgcggccggaggtgggggagcacgtcacgagcctcgacatg
gcgggcctctcgttgaccctgacgctcctggaccccgagctcgagaccctgtggctcgcg
ccggtggacgccccggcgctgcgccgcggcgcgcccgcaccggcagcgaccggggagcgg
cgcgacgcccgggacgtcgaccggccggaggaggtcgctgtcgcggagggaacgcccgag
tcccgccgcgcggccgccgtcgctctcgacgcactggctgccgtgtgccgggccctgcgg
gaggccgagaccgagctcggggcgctcgacgccgtcgccggggacggcgaccacggccag
ggcatggtgctcggggccgccggggcgctcgccgcgggccgggcggcgcacgactccggc
gccggcctggcctcggtgctccgctcgtgcggggcggcgtgggccgaggccgccggcggc
acgtccggcgcgctgtggggcggcgcgttgcgtgcggccgccgacgcgttcgacgacgcc
tcggcaccggacgccgctgccgtgctggtggccgtggaacgggccgccgaggcggtgacc
gcggccggcggtgcgtcggtcggcgacaagacgatggtcgacgccgtcgtgccgttcgtc
gaggcgctgcggagcgcgctcggcgacgccgcgcccgcggcggcctggagcaccgcggcg
gcggcggccgaccgcgcagccgcgggaacggcggatctggtggcgaggcgaggtcgggcg
cgcacgcacggcgaacgcgggatcggtcaccgggacccgggcgccgtctcgttcgccctg
gtgatgacggcggccgggcgggtccgcggggcggacctcgtcgaggccgctgcggacgca
cgagcgacggaggactga

DBGET integrated database retrieval system