KEGG   Beutenbergia cavernae: Bcav_2321Help
Entry
Bcav_2321         CDS       T00893                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00061  Fatty acid biosynthesis
bcv00780  Biotin metabolism
bcv01100  Metabolic pathways
bcv01130  Biosynthesis of antibiotics
bcv01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bcv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Bcav_2321
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Bcav_2321
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Bcav_2321
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bcv01004]
    Bcav_2321
Enzymes [BR:bcv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Bcav_2321
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Bcav_2321
Lipid biosynthesis proteins [BR:bcv01004]
 Fatty acid synthase
  Component type
   Bcav_2321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ACQ80572
UniProt: C5BVX1
LinkDB All DBs
Position
complement(2605753..2606520)
Genome map
AA seq 255 aa AA seqDB search
MGLLDGKSLLVTGVLTDASIAFHAARLAQEEGARVVLSSFGRQHRLTELTAKRLPQLAPV
VQLDVTNDEDLAALPERVREHTDSLDGVVHSIGFAPQSVMGGNFLAGEWSDVATALEVSA
FSLKSLAVAARPLMPSGGSVVGLTFDARFAWPVYDWMGVAKAAFEATSRYLARDLGPDKI
RVNVVSAGPLKTTAARSIPGFETMEGGWDDRAPLGWDSADPEPAARAVVALCSDWFPATT
GEMLHVDGGVHAMGQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggtcttctcgacggcaagtcgctgctcgtcaccggcgtcctcaccgacgcctcgatc
gcgttccacgccgcacgcctcgcgcaggaggagggggcgcgcgtcgtcctgtcgtccttc
gggcgccagcaccggctcacggagctgacggcgaagcgtctgccgcagctggcgccggtg
gtgcagctcgacgtcacgaacgacgaggacctggccgcactgcccgagcgggtgcgcgag
cacaccgactccctcgacggcgtcgtgcactcgatcgggttcgcgccgcagtcggtcatg
ggcgggaacttcctcgccggtgagtggtccgacgtcgcgacggcgctcgaggtctccgcg
ttctcgctcaagtccctcgccgtcgcggcgcggccgctcatgccgagcggggggtccgtg
gtcgggctcacgttcgacgcgcgcttcgcgtggccggtctacgactggatgggcgtcgcg
aaggccgcgttcgaggccacctcccgctacctcgcccgcgacctcgggccggacaagatc
cgcgtcaacgtcgtgtcggcggggccgctgaagacgacggcggcgcgctcgatccccggc
ttcgagacgatggagggcggctgggacgatcgcgcgccgctcggctgggactccgccgac
ccggagcctgccgcgcgcgccgtcgtcgcactgtgctccgactggttcccggcgacgacg
ggcgagatgctgcacgtcgacggcggcgtgcacgcgatggggcagtag

DBGET integrated database retrieval system