KEGG   Beutenbergia cavernae: Bcav_2735Help
Entry
Bcav_2735         CDS       T00893                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00620  Pyruvate metabolism
bcv00680  Methane metabolism
bcv01100  Metabolic pathways
bcv01120  Microbial metabolism in diverse environments
bcv01200  Carbon metabolism
Module
bcv_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bcv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcav_2735
  09102 Energy metabolism
   00680 Methane metabolism
    Bcav_2735
Enzymes [BR:bcv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Bcav_2735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 SnoaL
Motif
Other DBs
NCBI-ProteinID: ACQ80980
UniProt: C5BY80
LinkDB All DBs
Position
complement(3039319..3041985)
Genome map
AA seq 888 aa AA seqDB search
MTGSSNGRGGAVHEMPDELRADVRLLGELLGEVLSETGGPELLDDVERLRGLTIAAYGAG
EASAITQAEALVDSFTPERAADVARAFTCYFHLVNLAEEYHRVRTLRQRDRERGESEGPA
SADSLPGALAQLRAEVGEEETSRRLAGLEFRPVLTAHPTEARRRAVAAAIRRISELVAER
DDPRLGATTLAEIRRRMLGEIDTLWRTSPLRTSKPSPLDEVRTAMGVFDETLFQVLPQVY
RILDDHLLGADAGRVAPRAPAFVRLGSWIGADRDGNPNVTAKVTRAAASIAAEHVLLGLE
RAATRIGRALTLDATSTPPSGELLALWRRQQSVDEELTAEIAARAPDEPYRRVVLVIAER
IAATRRRDADLAYADPEELLADLDVVQASLVAAGDARGAYGELQHLIWQVRTFGFHLAEL
EVRQHSKVHALTLAEIEAKGVDGDLDPVAVEVLEVFRVIATIQQRYGQLAARRYIVSFTM
SADDIAAVYRLAELALGSAEAAPVLDVVPLFETFADLEASTDVLDAMVTQPQVQARLAAT
GRRLEVMLGYSDSAKDVGPVSATLALYDAQSRIARWAQDNDIVLTLFHGRGGALGRGGGP
ANRAVLAQPPNSVDGRFKLTEQGEVIFARYGNPHIATRHIEQVAAATLLASAPSIEERNS
SAAATYADVAARMDTVSRSRFYDLVQAEGFPQWFAEVTPQEEVGLLALGSRPAKRGLSVN
SLEDLRAIPWVFAWTQARINLTGWFGLGAALDAVGDLELLRRAYAEWPLFTTMIDNVEMS
LAKTDERIARRYLELGDREDLAALVLDELALTRRWVLDITGHERLLATSRVLGRAVQLRS
PYVDALSLIQLRALRALREGADEAKVPELQRLLLLSVNGVAAGLQNTG
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgaccggatcgtcgaacgggcgcggaggcgccgtgcacgagatgccggacgagctgcgc
gccgacgtgcggctgctgggtgagctgctcggggaggtgctgtccgagaccgggggaccg
gagctgctcgacgacgtcgagcgcctgcgcgggctcacgatcgccgcgtacggcgcgggt
gaggcgagcgcgatcacccaggccgaggcgctcgtcgactccttcacgccggagcgcgcg
gccgacgtcgcgcgagcgttcacgtgctacttccacctggtcaacctcgccgaggagtac
caccgggtgcggaccctgcggcagcgggaccgcgagcgcggcgagagcgagggtccggcg
tcggccgactccctgcccggtgcgctcgcgcagctgcgcgccgaggtcggcgaggaggag
acctcgcgccggctcgccgggctcgagttccgcccggtcctcacggctcaccccacggag
gcgcgccgacgcgctgtcgccgccgccatccggcgcatctcggagctcgtcgcggagcgc
gacgacccgcgcctcggcgccaccacgctggccgagatccgtcgccgcatgctgggcgag
atcgacacgctgtggcgcacctcaccgttgcggacgtcgaagccgtcgccgctcgacgag
gtccgcacggcgatgggcgtgttcgacgagacgctcttccaggtgctgccccaggtctac
cggatcctcgacgaccacctgctcggcgccgacgccggccgcgtggcgccccgcgcgccc
gcgttcgtgcgcctcgggagctggatcggcgcggaccgcgacggcaacccgaacgtcacc
gcgaaggtcacccgggccgcggcgagcatcgccgccgagcacgtgctgctcgggctcgag
cgcgccgccacgcggatcggccgagcgctcacgctcgatgccacgagcacgcccccgtcg
ggcgagctgctcgcgctgtggcgcaggcagcagtccgtggacgaggagctgacggcggag
atcgcggcgcgcgcacccgacgagccctaccggcgggtcgtgctcgtgatcgccgagcgc
atcgccgcgacccggcgacgcgacgcggacctcgcgtacgccgaccccgaggagctgctc
gccgacctcgacgtcgtccaggcctcgctcgtggcggcgggcgacgcgcgcggggcgtac
ggcgagctccagcacctcatctggcaggtgcggacgttcgggttccacctcgccgagctc
gaggtgcggcagcactccaaggtccacgccctcaccctcgccgagatcgaggcgaagggg
gtcgacggcgacctcgaccccgtcgccgtcgaggtcctcgaggtgttccgcgtcatcgcg
acgatccagcagcgctacggccagctcgcggcgcgccgctacatcgtctcgttcacgatg
tcggcggacgacatcgccgccgtgtaccggctcgccgagctcgccctgggctcggccgag
gcggcaccggtgctcgacgtcgtgccgctgttcgagacgttcgcggacctggaggcgagc
accgacgtgctcgacgccatggtcacgcagccgcaggtccaggcgaggctggcggcgacc
ggtcgacggctcgaggtcatgctcgggtactccgactccgcgaaggacgtcggtccggtc
tccgccacgctcgcgctctacgacgcgcagagccgcatcgcgcgctgggcgcaggacaac
gacatcgtgctcacgctcttccacggtcggggcggcgctctcggccggggcggcggcccg
gccaaccgcgccgtcctcgcccagccgccgaactccgtggacggtcgcttcaagctgacc
gagcagggggaggtcatcttcgcgcggtacggcaacccgcacatcgccacgcggcacatc
gagcaggtggccgcggccacgctgctcgcctccgcgccgtcgatcgaggaacgcaactcc
tcggccgccgccacgtacgcggacgtcgccgcacgcatggacacggtgtcgcggagccgg
ttctacgacctcgtgcaggccgaggggttcccgcagtggttcgccgaggtcacgccgcag
gaggaggtgggtctgctcgcgctcgggtcccgcccggcgaagcgcggactgtcggtcaac
tcgctcgaggacctgcgagcgatcccgtgggtgttcgcgtggacccaggcacggatcaac
ctcaccggctggttcggcctcggcgccgcgctcgacgccgtcggggacctcgagctgctg
cgccgggcgtacgccgagtggccgctcttcacgacgatgatcgacaacgtcgagatgtcg
ctggcgaagacggacgagcgcatcgcacgccggtatctcgagctgggcgaccgggaggac
ctggccgcgctcgtgctcgacgagctggccctcacccggcgctgggtgctcgacatcacg
ggccacgagcggctgctcgccacgtcccgggtgctcggacgcgccgtccagctgcgctcg
ccgtacgtcgacgctctctcgctcatccagctgcgcgccctccgcgcgctgcgcgagggg
gccgacgaggcgaaggtccccgagctgcagcgactcctgctgctgtcggtgaacggcgtc
gccgcaggactgcagaacaccgggtga

DBGET integrated database retrieval system