KEGG   Beutenbergia cavernae: Bcav_3007Help
Entry
Bcav_3007         CDS       T00893                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00020  Citrate cycle (TCA cycle)
bcv00480  Glutathione metabolism
bcv01100  Metabolic pathways
bcv01110  Biosynthesis of secondary metabolites
bcv01120  Microbial metabolism in diverse environments
bcv01130  Biosynthesis of antibiotics
bcv01200  Carbon metabolism
bcv01210  2-Oxocarboxylic acid metabolism
bcv01230  Biosynthesis of amino acids
Module
bcv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcv_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bcv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcav_3007
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcav_3007
Enzymes [BR:bcv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Bcav_3007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: ACQ81252
UniProt: C5BZS2
LinkDB All DBs
Position
complement(3355145..3356362)
Genome map
AA seq 405 aa AA seqDB search
MAKIKVAGPVVELDGDEMTRIIWQFIKDRLIHPYLDVDLRYYDLSIESRDATDDQITIDA
ANAIKEHHVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIIISNVPRL
VPGWTKPIIIGRHAHGDQYKATDFRVPGAGELTVTFTPADGSEPIQHVIAEYGADGGVAM
GMYNYDDSIRDFARASFSYGLQRSYPVYLSTKNTILKAYDGRFKDLFADVFETEFKADFD
AAGLTYEHRLIDDMVASAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
QTVEAEAAHGTVTRHYRQHQAGKPTSTNPIASIFAWTGGLKHRGKLDGTPEVTGFAEALE
DVVVKSVEAGAMTKDLALLVGPDQAWQTTEEFLATLDENLAARLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggtcgcgggaccggtcgtcgagctcgacggcgacgagatgacgcgg
atcatctggcagttcatcaaggaccgcctgatccacccgtacctcgacgtcgacctgcgc
tactacgacctgtcgatcgagagccgggacgcgacggacgaccagatcaccatcgacgcg
gcgaacgccatcaaggagcaccacgtcggcgtcaagtgcgccacgatcacgccggacgag
gcgcgcgtcgaggagttcggcctcaagaagatgtggcgctccccgaacggcacgatccgc
aacatcctgggcggcgtcgtcttccgcgagccgatcatcatctcgaacgtgccgcggctg
gtgccgggctggacgaagccgatcatcatcggccgtcacgcccacggcgaccagtacaag
gcgacggacttccgcgtgcccggtgccggcgagctgaccgtcacgttcacgccggccgac
ggctcggagccgatccagcacgtcatcgccgagtacggagccgacggcggcgtcgcgatg
ggcatgtacaactacgacgactcgatccgggacttcgcccgggcgtcgttctcctacggc
ctgcagcgcagctaccccgtgtacctgtcgacgaagaacacgatcctcaaggcgtacgac
ggccgcttcaaggacctgttcgccgacgtgttcgagaccgagttcaaggcggacttcgac
gccgcgggcctcacctacgagcaccgcctcatcgacgacatggtcgcctcggccatgaag
tgggagggcggctacgtctgggcctgcaagaactatgacggcgacgtccagtcggacacc
gtggcgcagggcttcggctcgctcggcctcatgacctccgtgctcatgacgccggacggc
cagacggtcgaggccgaggccgcgcacggcaccgtcacgcgccactaccggcagcaccag
gccggcaagccgacgtcgaccaacccgatcgcgtcgatcttcgcgtggacgggcggcctc
aagcaccgcggcaagctggacggcacccccgaggtgaccgggttcgccgaggcgctcgag
gacgtcgtcgtgaagtccgtcgaggccggtgccatgacgaaggacctcgcgctgctcgtc
ggcccggaccaggcgtggcagacgaccgaggagttcctcgccacgctcgacgagaacctc
gccgcgcgcctcgcctga

DBGET integrated database retrieval system