KEGG   Beutenbergia cavernae: Bcav_3564Help
Entry
Bcav_3564         CDS       T00893                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00020  Citrate cycle (TCA cycle)
bcv00190  Oxidative phosphorylation
bcv00650  Butanoate metabolism
bcv01100  Metabolic pathways
bcv01110  Biosynthesis of secondary metabolites
bcv01120  Microbial metabolism in diverse environments
bcv01130  Biosynthesis of antibiotics
bcv01200  Carbon metabolism
Module
bcv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bcv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bcv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcav_3564
   00650 Butanoate metabolism
    Bcav_3564
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Bcav_3564
Enzymes [BR:bcv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Bcav_3564
    1.3.5.4  fumarate reductase (quinol)
     Bcav_3564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_17 Fer4_7 Fer4_18 Fer4_10 Fer2_4
Motif
Other DBs
NCBI-ProteinID: ACQ81806
UniProt: C5C2W2
LinkDB All DBs
Position
complement(3958895..3959647)
Genome map
AA seq 250 aa AA seqDB search
MSYTGRFRVWRGDDDGGELRDFDVEVNEGEVVLDVLHRLQATQTPDLAVRWNCKAGKCGS
CSAEINGRPRLLCMTRMSVFTPDEVVTITPMRTFPVIRDLVTDVSFNYTKAREVPSFTPP
ADLAPGEYRMQQMDVERSQEFRKCIECFLCQNTCHVVRDHDENKEAFSGPRYLMRVAELE
MHPLDVVDRVPAAQEEHGLGLCNITKCCTDVCPEHIQITDNALIPMKERVADRRYDPLVW
LGRTISRRRG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagctacacgggccggttccgggtgtggcggggcgacgacgacggcggcgagctgcgc
gacttcgacgtggaggtgaacgagggcgaggtggtgctcgacgtcctccaccggctgcag
gcgacgcagacgccggacctcgcggtgcgctggaactgcaaggcgggcaagtgcggctcg
tgctccgcggagatcaacggccgacctcgcctgctgtgcatgacgcggatgtccgtgttc
acgcccgacgaggtcgtgacgatcacgccgatgcggacgttcccggtgatccgcgacctc
gtgaccgacgtgtcgttcaactacacgaaggcgcgcgaggtcccgtcgttcacgccgccg
gccgacctcgcgccgggcgagtaccgcatgcagcagatggacgtcgagcgctcgcaggag
ttccgcaagtgcatcgagtgcttcctctgccagaacacgtgccacgtggtgcgcgaccac
gacgagaacaaggaggcgttctccggcccgcgctatctcatgcgggtcgcggagctcgag
atgcacccgctcgacgtggtggaccgcgtgccggccgcgcaggaggagcacggcctcggg
ctgtgcaacatcacgaagtgctgcaccgacgtctgcccggagcacatccagatcaccgac
aacgccctaatcccgatgaaggagcgggtcgccgaccggcggtacgacccgctggtgtgg
ctcggtcggacgatctcgcgccgtcgcggctga

DBGET integrated database retrieval system