KEGG   Beutenbergia cavernae: Bcav_3565Help
Entry
Bcav_3565         CDS       T00893                                 

Definition
(GenBank) Succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bcv  Beutenbergia cavernae
Pathway
bcv00020  Citrate cycle (TCA cycle)
bcv00190  Oxidative phosphorylation
bcv00650  Butanoate metabolism
bcv01100  Metabolic pathways
bcv01110  Biosynthesis of secondary metabolites
bcv01120  Microbial metabolism in diverse environments
bcv01130  Biosynthesis of antibiotics
bcv01200  Carbon metabolism
Module
bcv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bcv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bcv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcav_3565
   00650 Butanoate metabolism
    Bcav_3565
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Bcav_3565
Enzymes [BR:bcv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Bcav_3565
    1.3.5.4  fumarate reductase (quinol)
     Bcav_3565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like GIDA DAO Thi4 Pyr_redox_3 FAD_oxidored FAD_binding_3 NAD_binding_8 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ACQ81807
UniProt: C5C2W3
LinkDB All DBs
Position
complement(3959644..3961578)
Genome map
AA seq 644 aa AA seqDB search
MTETERHDYDVLVIGAGGAGLRAAIEARQRGLRTAVICKSLFGKAHTVMAEGGCAAAMGN
VNSNDSWQVHFRDTMRGGKFLNNWRMAELHAKEAPERVWELETYGALFDRTADGRISQRN
FGGHTYPRLAHVGDRTGLELIRTMQQKIVSLQQEDYAATGDYEARLRVFAECTITELLTG
DDGAIAGAFGYWRESGRFVVFSAPAVVLATGGIGKSFKVTSNSWEYTGDGHALAMRAGAG
LIDMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSAGERFMFNYVPDVFKGQYAET
VEEADAWYTDQENNRRTPDLLPRDEVARAINTEVKEGRGSPHGGVFLDIASRMPADEIQR
RLPSMYHQFKELADVDITAEPMEVGPTCHYVMGGIEVDPDTGSSSVPGLFAAGECSGGMH
GSNRLGGNSLSDLLVFGRRAGLGAADYVSGLESRPAVRAAAVDDAAAMAVAPFDPAADGG
SGENPYTLHAELQTAMNDLVGIIRTEAEMQAALERLGELRERVRGVVVEGHRQYNPGWHL
ALDLRNMLMVGEAVASSALLRTESRGGHTREDHPGMDAQWRHRVLVTRCADHGGGDPVVP
RVVVEPEERAPMRDDLLALFDLTELEKYYTGGELASHPEQGASA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgagaccgaacgacacgactacgacgtcctcgtcatcggggctggtggtgcgggc
ctgcgggccgcgatcgaggcacgccagcgtggcctgcggacggccgtcatctgcaagtcc
ctgttcggcaaggcgcacaccgtcatggcggagggcggctgcgcggcggcgatggggaac
gtcaactcgaacgacagctggcaggtgcacttccgcgacacgatgcgcggcgggaagttc
ctcaacaactggcgcatggcggagctgcacgcgaaggaggcacccgagcgcgtctgggag
ctcgagacgtacggggcgctgttcgaccgcacggccgacggccggatcagtcagcgcaac
ttcggcgggcacacgtacccgcggctcgcgcacgtcggcgaccgcaccggcctcgagctc
atccgcacgatgcagcagaagatcgtgtcgctgcagcaggaggactacgcggccaccggc
gactacgaggcgcggctgcgcgtgttcgcggagtgcaccatcaccgagctgctcaccggc
gacgacggcgcgatcgccggggcgttcgggtactggcgggagtccggccgattcgtcgtg
ttctccgcgccggccgtggtgctcgcgacgggcggcatcgggaagtcgttcaaggtgacg
tcgaactcgtgggagtacacgggcgacgggcacgccctggcgatgcgcgccggagccggg
ctcatcgacatggagttcgtgcagttccaccccacgggcatggtgtggccgccgagcgtg
aaggggatcctcgtcaccgaaggcgtgcgcggcgacggcggcgtgctcaagaactctgcc
ggcgagcggttcatgttcaactacgtcccggacgtgttcaagggtcagtacgcggagacc
gtggaggaggcggacgcctggtacaccgaccaggagaacaaccgccggacgccggacctc
ctgccgcgcgacgaggtggcacgggcgatcaacaccgaggtcaaggagggtcgcggctcg
ccgcacggcggcgtgttcctcgacatcgcgagccggatgccggcggacgagatccagcgc
cggctgccgtcgatgtaccaccagttcaaggagctggccgacgtcgacatcaccgccgag
cccatggaggtcggccccacgtgccactacgtcatgggcggcatcgaggtggacccggac
acggggtcctcgagcgtgcccgggctgttcgcggcaggggagtgctccggcgggatgcac
ggctcgaaccggctgggcggcaactcgctctcggacctgctcgtgttcgggcggcgtgcc
gggctcggcgccgccgactacgtctccggcctcgagtcacgtccggccgtgcgcgccgcc
gccgtcgacgacgccgcggccatggccgtcgcgcccttcgaccccgcggccgacgggggt
tccggggagaacccgtacacgctgcacgccgagctgcagacggcgatgaacgacctcgtc
ggcatcatccggaccgaggccgagatgcaggcggcgctggagcggctcggcgagctgcgg
gagcgcgtgcgcggcgtcgtcgtcgagggacaccggcagtacaacccgggatggcacctg
gcgctcgacctgcggaacatgctcatggtgggggaggcggtcgcgtcgtcggccctgctg
cgcacggagagccgcggcggccacacgcgagaggaccacccggggatggacgcgcagtgg
cggcaccgggtgctcgtcacgcggtgcgccgaccacggcggcggcgacccggtggtgccg
cgcgtcgtcgtcgagccggaggagcgggcgccgatgcgcgacgacctgctcgcgctcttc
gacctcaccgagctcgagaagtactacaccgggggcgagctggcctcgcacccggagcag
ggagcgagcgcatga

DBGET integrated database retrieval system