KEGG   Borrelia crocidurae: Q7M_246Help
Entry
Q7M_246           CDS       T02051                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bcw  Borrelia crocidurae
Pathway
bcw00564  Glycerophospholipid metabolism
bcw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Q7M_246
Enzymes [BR:bcw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Q7M_246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 Flu_B_NS1 FAD_binding_3 NAD_binding_8 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AFI31025
UniProt: I0FC19
LinkDB All DBs
Position
253946..255508
Genome map
AA seq 520 aa AA seqDB search
MLEHKKKVLGDIDNQNFDLIIIGGGATGLGISIDSITRGYKTLLIEKNDYAKGTSSRSTK
LIHGGVRYLAQFNLPLVKEALYEQALLEINAPHLVNKRAFITPIYNILSIPYYYLGLSWY
HNLLGKHKKHKYKTKLLSKSETIKKIPNIKTKGLKCSVLYYDDSFDDARMAISMLRTFIN
KGGNAFNYTELTKFIKKNGKISGAIIRDTITGKQVTVKSKCIINATGIFSDKIRKLDDIN
APNIIKPSQGTHLIIKKEKLNTQYAMLMPKTNDNRILFTVPWYDVIICGSTDIAIDKIEE
EPKGLDSEIEFLLNNMNNYLNIKINRNDILSTYAGIRPLIIDPKGQQNTSKISRNEKIFI
SNSNLITIAGGKYTTYRKMAEKALTKAINENLIPAAMSITENLKIHGYMQREEINKIPEH
FRVYGSDFQYLSKMKEFKNKIHKELPLNEAQIIFAIEFEQAKTVEDILSRRTRSLLFNAK
ATIEATPKVAEIMMHKLGKSETWKNEQIKNFKKVAKKYLI
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctagaacataaaaaaaaagtattgggggatattgataatcaaaactttgacttaata
ataattggtggaggagcaacaggccttggcattagtatagattcgattacaagaggatat
aaaaccttacttatagaaaaaaatgactatgccaaaggcacatcttctcgatcaactaaa
ttaatacatggaggcgtaagatatttagcacaatttaacttacccttggtaaaagaggct
ttatatgaacaagctttgcttgaaataaatgcccctcacctagtaaataaacgtgcattt
attacgcccatatataatattttaagtattccttattactatttaggactcagttggtat
cacaaccttcttggaaaacataaaaaacacaagtataaaacaaaattgttatcaaaatca
gaaacaatcaaaaaaatacctaacattaaaaccaaagggctcaaatgttctgttttatac
tatgatgactcgtttgatgatgccagaatggcaattagtatgcttagaacttttattaat
aaaggaggaaatgcttttaattatacagaacttacaaaatttattaaaaaaaacggtaaa
atatctggtgctattattcgagacacaataactggcaaacaagttactgttaagagtaaa
tgtataataaatgcaacgggtatcttttcagacaaaattaggaaattagatgatattaat
gctcctaacatcataaagccttctcaaggaactcatctgataatcaaaaaagaaaaacta
aatacacaatatgcaatgctaatgcctaaaacaaatgataatagaattttattcaccgta
ccttggtatgatgtcattatctgtggaagtacagatatagcaatagataaaatcgaagaa
gagcccaaaggattagatagtgaaattgaatttttattaaacaacatgaacaattattta
aatattaaaatcaacagaaatgatattctaagcacatatgcaggaattagaccattaata
atagaccctaaaggacaacaaaacacatctaaaatatcaagaaatgaaaaaatattcata
tcaaactcaaatctcatcacaattgccgggggcaaatacactacctatagaaagatggct
gaaaaagctttaacaaaagcaataaacgaaaatttaatacctgcagcaatgtcaataaca
gaaaatttaaaaatacacggatatatgcaacgagaagaaatcaacaaaataccagaacac
tttagagtctatggaagtgattttcaatatctaagtaaaatgaaagaatttaaaaataaa
atccataaagaattaccattaaatgaagctcaaataatttttgccattgaatttgaacaa
gcaaaaaccgttgaagatattttatccagaagaacaagatcactgctcttcaatgcaaaa
gcaacaatcgaagctacaccaaaagttgctgaaattatgatgcataaacttggcaaatcc
gaaacttggaaaaatgagcaaataaaaaactttaaaaaagtagcaaaaaaatatttaatc
taa

DBGET integrated database retrieval system