KEGG   Bacillus cereus 03BB102: BCA_3802Help
Entry
BCA_3802          CDS       T00869                                 

Definition
(GenBank) collagen triple helix repeat protein
Organism
bcx  Bacillus cereus 03BB102
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collagen
Motif
Other DBs
NCBI-ProteinID: ACO28822
UniProt: A0A158RNM3
LinkDB All DBs
Position
3554599..3558174
Genome map
AA seq 1191 aa AA seqDB search
MSRYDDSQNKFSKPCFPSSAGRIPNTPSIPVTKAQLRTFRAIIIDLTKIIPKLFANPSPQ
NIEDLIDTLNLLSKFICSLDAASSLKAQGLAIIKNLITILKNPTFVASAVFIELQNLINY
LLSITKLFRIDPCTLQELLKLIAALQTALVNSASFIQGPTGPTGPTGPAGATGPQGVQGN
TGATGATGPQGAQGNTGATGATGPQGAQGNTGATGPQGAQGPAGATGATGPQGAQGNTGA
TGPQGAQGPAGATGATGPQGAQGNTGATGPQGIQGNTGATGATGIGVTGPTGPPGPTGPQ
GNTGATGATGPQGVQGNTGATGATGPQGAQGPAGATGATGPQGVQGPAGATGATGPQGVQ
GNTGATGPQGVQGNTGATGATGPQGVQGNTGATGPQGVQGNTGATGATGPQGVQGNTGAT
GATGPQGVQGPAGATGATGPQGIQGPAGATGATGPQGVQGNTGATGATGPQGAQGPAGAT
GATGPQGVQGPAGATGATGPQGVQGPAGATGATGPQGVQGNTGATGPQGVQGNTGATGAT
GPQGVQGNTGATGATGPQGVQGPAGATGATGPQGIQGPAGATGATGPQGVQGNTGATGAT
GPQGAQGPAGATGATGPQGVQGNTGATGATGPQGAQGPAGATGATGPQGVQGNTGATGAT
GPQGAQGPAGATGATGPQGVQGPAGATGATGPQGVQGPAGATGATGPQGVQGPAGATGAT
GPQGVQGPAGATGATGPQGVQGNTGATGATGPQGAQGNTGATGPQGVQGPAGATGATGPQ
GAQGPAGATGATGPQGAQGNTGATGPQGAQGPAGATGATGPQGAQGNTGATGPQGVQGPA
GATGATGPQGAQGPAGATGATGPQGVQGPAGATGATGPQGAQGNTGATGPQGAQGPAGAT
GATGPQGVQGPAGATGATGPQGAQGPAGATGATGPQGAQGPAGATGATGPQGIQGPAGAT
GATGPQGVQGPTGATGIGVTGPTGPSGGPPGPTGPQGPQGNTGATGPQGIQGPAGATGAT
GPQGAQGPAGATGATGPQGVQGPTGATGIGVTGPTGPSGPSFPVATIVVTNNIQQTVLQF
NNFIFNTAINVNNIIFNGTDTVTVINAGIYVISVSISTTAPGCAPLGVGISINGAVATDN
FSSNLIGDSLSFTTIETLTAGANISVQSTLNEITIPATGNTNIRLTVFRIA
NT seq 3576 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgttatgacgacagtcaaaacaaattctccaaaccatgctttccaagtagcgct
ggacgaatcccgaatactccatcaatcccagttactaaggcacaacttagaacatttcgc
gcaatcattattgatttaacaaaaataatcccaaaacttttcgcaaatccatctccccaa
aatattgaagatctaatcgatacattgaacctactaagtaaatttatttgttcactagac
gctgcttcctccctgaaagcacaaggattagctattattaaaaacttaataactatatta
aaaaacccaactttcgtagcaagtgctgtatttatcgagcttcaaaatctaattaattat
ttactatccattacaaaactattccgaattgacccttgcacacttcaagagcttcttaaa
ttaatagcagcattacaaaccgctttagttaattctgcttcattcattcaaggacctact
ggacctactgggcctactgggccagctggtgctactggacctcagggtgttcaaggtaac
acgggcgctactggtgccactggacctcaaggtgctcaaggtaacacaggtgctactggt
gccactggacctcaaggtgctcaaggtaacacaggcgctactggacctcaaggcgctcaa
ggaccagcgggtgctactggcgctactggacctcaaggtgctcaaggtaacacaggtgct
actggacctcaaggcgctcaaggaccagcgggtgctactggcgctactggacctcaaggt
gctcaaggtaacacaggtgctactggacctcagggtattcaaggtaacacgggcgctact
ggtgctaccggcataggagttaccggacctactgggcctcctggacctactggacctcaa
ggtaacacaggtgctactggtgccactggacctcaaggtgttcaaggtaacacaggtgct
actggtgccactggacctcaaggcgctcaaggaccagcaggtgctactggcgctactgga
cctcaaggtgttcaaggaccagcaggcgctactggcgctactggacctcaaggcgttcaa
ggtaacacaggtgctactggacctcagggtgttcaaggtaacacaggtgctactggtgct
actggacctcaaggcgttcaaggtaacacaggtgctactggacctcagggtgttcaaggt
aacacaggtgctactggcgctactggacctcaaggcgttcaaggtaacacaggtgctact
ggcgctactggacctcagggtgttcaaggaccagcgggtgctaccggtgccactggacct
caaggtattcaaggaccagcaggtgctactggcgctactggacctcaaggcgttcaaggt
aacacgggtgctactggtgccactggacctcaaggcgctcaaggaccagcgggtgctact
ggtgccactggacctcaaggtgttcaaggaccagcgggtgctactggtgccactggacct
caaggtgttcaaggaccagcaggcgctactggcgctactggacctcaaggcgttcaaggt
aacacaggtgctactggacctcagggtgttcaaggtaacacaggtgctactggcgctact
ggacctcaaggcgttcaaggtaacacaggtgctactggcgctactggacctcagggtgtt
caaggaccagcgggtgctaccggtgccactggacctcaaggtattcaaggaccagcaggt
gctactggcgctactggacctcaaggcgttcaaggtaacacgggtgctactggtgccact
ggacctcaaggcgctcaaggaccagcaggtgctactggtgccactggacctcaaggtgtt
caaggtaacacaggtgctactggcgctactggacctcaaggcgctcaaggaccagcgggt
gctactggcgctactggacctcaaggcgttcaaggtaacacgggtgctactggtgccact
ggacctcaaggcgctcaaggaccagcgggtgctactggtgccactggacctcaaggtgtt
caagggccagcaggtgctaccggtgccactggacctcaaggtgttcaaggaccagcaggt
gctaccggtgctactggacctcaaggtgttcaaggaccagcaggtgctaccggtgctact
ggacctcaaggtgttcaagggccagcaggtgctaccggtgccactggacctcaaggtgtt
caaggtaacacgggtgctactggtgccactggacctcaaggtgctcaaggtaacacgggc
gctactggacctcaaggtgttcaaggaccagcaggtgctactggcgctactggacctcaa
ggtgctcaaggaccagcaggtgctaccggtgccactggacctcaaggtgctcaaggtaac
acgggcgctactggacctcaaggtgctcaaggaccagcaggtgctaccggtgccactgga
cctcaaggtgctcaaggtaacacgggcgctactggacctcaaggtgttcaaggaccagca
ggtgctaccggtgctactggacctcaaggtgctcaaggaccagcaggtgctactggtgcc
actggacctcaaggcgttcaaggaccagcaggtgctaccggtgccactggacctcaaggt
gctcaaggtaacacgggcgctactggacctcaaggtgctcaaggaccagcaggtgctacc
ggtgctactggacctcaaggcgttcaaggaccagcaggcgctaccggtgctactggacct
caaggcgctcaaggaccagcaggcgctaccggtgctactggacctcaaggtgctcaagga
ccagcaggtgctactggtgccactggacctcaaggtattcaaggaccagcaggtgccact
ggcgctactggacctcaaggtgttcaagggccaacgggcgctactggtataggagttacc
ggacctactgggccttctggtgggcctcctggacctactggacctcagggacctcaaggt
aatacaggtgctactggacctcaaggtattcaagggcctgctggtgctactggtgccact
ggacctcaaggtgctcaaggaccggctggtgctaccggcgctactggacctcaaggtgtt
caagggccaacgggtgctactggtataggagttaccggacctactgggccttctggacct
agcttccctgtagcaacaattgttgtaacaaacaacattcaacaaacagtactccaattt
aacaacttcatttttaatactgcaattaacgtaaacaacattatcttcaacggcacagat
acagttactgttatcaacgctggtatttatgtcattagcgtatccatctctacaactgca
ccaggatgtgcaccactcggagtaggaatttcaataaatggagcagtcgcaactgacaac
ttctcttcaaatctaataggcgactcactttcattcactacgatcgaaacgttaactgcc
ggcgcgaacatttctgtccaatccactcttaatgagattacgatccctgcaacaggaaac
actaatattcgtctaactgtatttagaatcgcttaa

DBGET integrated database retrieval system