KEGG   Bacillus cereus 03BB102: BCA_4107Help
Entry
BCA_4107          CDS       T00869                                 

Definition
(GenBank) hypothetical protein
Organism
bcx  Bacillus cereus 03BB102
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Holin_SPP1
Motif
Other DBs
NCBI-ProteinID: ACO28150
UniProt: A0A158RLX5
LinkDB All DBs
Position
3859308..3859541
Genome map
AA seq 77 aa AA seqDB search
MLQKENLSDIIRLLAGFLLSLKLLFNSFGINFITNDQIDAIVNVASFLFILYFGFKNNYV
GKKGIEQKKVLKKHNLH
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgctacaaaaagaaaatctatcagatattatacgtttactagcgggctttctattatcc
ttaaaattactattcaattctttcggaataaactttattacaaacgatcaaatcgatgct
attgtgaatgttgcttcatttttatttattctatactttggcttcaaaaataactatgta
ggaaaaaaaggaatagaacaaaagaaagtactcaaaaaacacaatcttcactaa

DBGET integrated database retrieval system