KEGG   Bacillus cytotoxicus: Bcer98_0231Help
Entry
Bcer98_0231       CDS       T00560                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
bcy  Bacillus cytotoxicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like MFS_2 MFS_3 Sugar_tr LacY_symp PTR2 OATP UNC-93
Motif
Other DBs
NCBI-ProteinID: ABS20597
UniProt: A7GKD9
LinkDB All DBs
Position
241656..242930
Genome map
AA seq 424 aa AA seqDB search
MKETWRELRGMDRNVWIRFIGETLNGIAMMMLMPFFALYLKDRVDSLFQVGIIMALSPIA
ASIGSLIGGRIADIYGRKPIMIFSMASNALLMLGFLFIEGFIPYAILSILLGFSNSLFHP
AASAMVADVTAPEKRTEAYGLLRMGHNIGAAIGPILGSLVVILSKDLVFMIAASTMLFYA
LLVFLLIRETMPKAQIAQSKGESKQRGSVWRVVLKDRVLMVYLLAGIIISMGFSQTEGML
PLHFDNEMKDILGKNNPYPYLMALNGLLVVLFQFQISKWATDKPVGKTMLYGAWLFGFGL
FFIGWVPKWFGNFGTNVTVLFIILLIIYAVYTLGEMIMSPVQMTFVANLAPEHLRGTYMG
AASLQWITGNAFGPLLGGVLLDRLLGHLLFTILAIGCIVAGLVYISLDHLVEKKQKENAV
KQSL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaacatggcgtgaattgagagggatggatcgtaatgtatggattcgatttata
ggagaaacgttaaatggaattgcgatgatgatgttgatgccgttttttgcattgtattta
aaagatcgtgtagattccttatttcaggtaggaattattatggcgctttctcctatcgca
gcgagtatcggttctcttatagggggaagaattgctgatatatatggaagaaagcccatt
atgattttttcgatggctagtaatgcgctcttgatgctcggctttttatttatagaagga
tttattccttatgctatattatctattcttttgggatttagtaactcgttatttcatcca
gcggcgtctgcaatggtagctgatgttactgcacctgaaaaaagaacagaggcatatggt
ctattgcggatgggacataatattggggcagcaattggaccgattctgggttcattggtc
gttatactatcaaaagaccttgtgtttatgattgcagcatctactatgttgttttatgca
ttacttgtcttcctattgattcgtgaaacaatgccgaaagctcagattgcccaatcaaaa
ggtgaaagtaagcaaagaggttctgtttggagagttgttttaaaagatagagttttaatg
gtttatttgttggcaggaattattatttcaatgggattttctcaaacggagggaatgctc
ccgcttcattttgataatgaaatgaaagatatattggggaaaaataatccgtacccatat
ttaatggctttaaatggcctactagttgttttatttcaatttcaaatttctaaatgggca
acagataagccggttgggaagacgatgttatatggtgcgtggctatttggatttggtttg
ttttttataggatgggtaccaaaatggtttggcaactttggaaccaatgtgacagttctc
ttcatcatattgctaattatatatgctgtatacacattaggagagatgattatgtctcct
gtacaaatgacatttgttgctaatttagcaccggaacatttacgcgggacatatatgggt
gcggcaagtttgcaatggattacagggaatgcgtttgggcctcttttaggaggtgtgtta
cttgaccgcttattagggcacttattatttacaattttagcgataggctgcatagtagca
ggtcttgtatacatatcattagatcatcttgttgaaaagaagcaaaaggaaaatgcagta
aagcaatctttataa

DBGET integrated database retrieval system