KEGG   Bacillus cytotoxicus: Bcer98_0232Help
Entry
Bcer98_0232       CDS       T00560                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00473  D-Alanine metabolism
bcy00550  Peptidoglycan biosynthesis
bcy01100  Metabolic pathways
bcy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Bcer98_0232
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bcer98_0232
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Bcer98_0232
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcy01011]
    Bcer98_0232
Enzymes [BR:bcy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Bcer98_0232
Peptidoglycan biosynthesis and degradation proteins [BR:bcy01011]
 Precursor biosynthesis
  Amino acid ligase
   Bcer98_0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ABS20598
UniProt: A7GKE0
LinkDB All DBs
Position
243252..244340
Genome map
AA seq 362 aa AA seqDB search
MTKIKLGLLYGGKSAEHQVSLQTALAAIKALNQEKFEIHPIYITEQGQWMRGERIEGEVT
SVQALQMSGEANAISPVSLSTEIIPAPASKQEEAIDVIFPLLHGPNGEDGTVQGLLELMN
IPYVGNGVLASAAGMDKVVMKNIFAEAGLNQAKYTSFVRSVWEKNREEAYEKVEEALGYP
CFVKPANLGSSVGINKCKDREELEKAFEEAFQFDRKIIVEENIIGREVEVGVLGNDDPKC
SVVGEIVPKKEFYDYKSKYIDGDTALIIPAEITEEETATIQRDAIRAFQALDGAGLTRAD
FFLTKDGEVYINEVNTMPGFTPFSMFPLLWQHTGLSYPELIEELIRLAIERHKEKQKIKY
TI
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
ttgacgaaaattaaattaggtttattatatggtgggaaatcagcagagcatcaagtttca
ttacaaacagctctagctgctattaaagcattaaatcaagaaaaattcgagattcatcca
atttatattacagagcaaggccaatggatgcgtggggaacgcattgaaggcgaagtaaca
agtgtgcaagctttacaaatgagtggagaagcgaatgccatttctccggtatcactaagt
acagaaattatccctgcacctgcttctaagcaagaggaagcaattgatgttattttccca
ttgctacacgggccaaacggtgaagatggaacggtacaaggactattagaattaatgaat
ataccatatgttgggaatggtgtgttagcatcagctgctggtatggataaagttgtgatg
aaaaatatttttgcagaggctggattaaaccaggcaaaatatacatctttcgttcgcagt
gtatgggagaaaaatcgtgaagaagcttatgaaaaagtagaagaagcgctaggatatcca
tgttttgtaaaaccagcaaaccttggatcaagcgttggtattaataaatgtaaagatcgt
gaagaattagagaaagcatttgaggaagctttccaatttgaccgtaaaattattgtagaa
gaaaatattatcggtcgtgaagtggaagtgggcgttttaggaaatgatgatccgaaatgt
tctgttgtaggtgaaatcgtacctaagaaagaattctatgattataaatcgaaatatatt
gatggtgatacagcattaattatccctgctgaaattacagaagaagaaacagctacaatt
caacgagatgcaattcgtgcattccaagctttggatggtgcgggtttaacaagagctgac
ttctttttaacaaaagatggcgaagtttatattaatgaagtaaatacaatgccaggattt
acaccatttagcatgttcccgttattatggcaacatacggggttgtcatatccagagtta
attgaagaattaattcgtttagcaattgagcgtcataaggaaaaacaaaaaattaaatat
acaatctaa

DBGET integrated database retrieval system