KEGG   Bacillus cytotoxicus: Bcer98_0238Help
Entry
Bcer98_0238       CDS       T00560                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00473  D-Alanine metabolism
bcy01100  Metabolic pathways
bcy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Bcer98_0238
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Bcer98_0238
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcy01011]
    Bcer98_0238
Enzymes [BR:bcy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Bcer98_0238
Peptidoglycan biosynthesis and degradation proteins [BR:bcy01011]
 Precursor biosynthesis
  Racemase
   Bcer98_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABS20604
UniProt: A7GKE6
LinkDB All DBs
Position
249928..251097
Genome map
AA seq 389 aa AA seqDB search
MEELSFYRDTWVEVDLDAIYNNVTRIKELIRDDVEIFAVVKGNAYGHGYVPVAKTALEAG
ATRLAVAFLDEALILRRAGITAPILVLGPSAPRDVNVAAEHDVTLTVFQKEWVEEAIKLW
NSPVSMKFHLNFDSGMGRIGIRERGELEGFLRSLENAPFLEFEGVYTHFATADEVETSYF
DKQYNTFLEQLSWLEKLGVSPRLVHAANSAATLRFHGITFNAVRIGIAMYGVTPSIEISP
FLPIQLEAALSLHSTVAHIKQVMKGDGVSYGVTYQTRTEEWIATIPIGYADGWLRRLQGF
KVLVNGKRVPIVGRVTMDQLMLRLPYKVSLGTKVTLIGKQGSEYIHAAEVAEYTSTINYE
IITTTSFRVPRIFIRNGKVVEVINYLNDI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaagaattatcgttttaccgtgatacgtgggttgaagtagacttggatgcaatttat
aacaatgttacgcgcattaaagaattaatccgagatgatgtagagatttttgctgtagta
aaagggaatgcatatggacatggctatgtaccagtagccaaaacagcattagaggccgga
gcgacaagattagcagttgcgtttttagatgaagctttgatccttcggcgtgcaggtatt
acagcacctattttagtattaggtccctcagcgccacgcgatgtaaatgtagctgcggaa
catgatgttacattaactgtgtttcaaaaagaatgggtggaagaagcgataaaactttgg
aatagtccagtttcaatgaaatttcatcttaactttgatagtggtatggggagaattggg
attcgtgagcgcggggaattagaaggatttttaagaagtttagaaaatgctccatttcta
gagtttgaaggagtttatacacattttgcaacagcggacgaagtagagacatcgtacttt
gataaacaatacaatacatttttagagcaactgagttggttggaaaaacttggagtcagt
ccgaggcttgttcatgcagcgaatagtgcagctactttgagattccatggaattacattt
aatgctgttcggatcggaattgcaatgtatggggtaacaccatctatagaaataagccct
tttttaccaatacaattagaagcggccctttctcttcattcaactgttgcacatattaag
caagttatgaaaggagatggggttagctatggtgttacgtatcagacgaggacggaggag
tggattgctaccataccgattggttatgcggatggctggcttagaagattacaaggattt
aaagtgcttgtaaatggaaaacgagttccgattgtaggtagagttacaatggaccaattg
atgttgcgtcttccttataaagtttctcttggtacaaaagtcacacttattggcaaacaa
gggagtgaatatattcacgcagcagaagttgcggagtacacaagtacgattaattacgag
attataacaacgactagttttcgtgtaccgcgtatattcattcgaaatgggaaagtagta
gaagtaatcaactatttgaatgatatataa

DBGET integrated database retrieval system