KEGG   Bacillus cytotoxicus: Bcer98_0314Help
Entry
Bcer98_0314       CDS       T00560                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bcy  Bacillus cytotoxicus
Brite
KEGG Orthology (KO) [BR:bcy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bcer98_0314
Enzymes [BR:bcy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Bcer98_0314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 Thioredoxin_3 GIDA FAD_oxidored HI0933_like FAD_binding_3 Thi4 AlaDh_PNT_C K_oxygenase DAO NAD_binding_8 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ABS20677
UniProt: A7GKL9
LinkDB All DBs
Position
complement(361161..362687)
Genome map
AA seq 508 aa AA seqDB search
MILDADIKAQLSQYLQLMESDILLKVSTGDDDVSKDMLALVDELTAMSSKIKVEKAQLER
TPSFSVNRIGEETGITFAGIPLGHEFTSLVLALLQVSGRAPKVEQKVIDQIKNIQGEYHF
ESYISLSCHNCPDVVQALNVMSVLNPGITHTMIDGAAFKEEVESKDIMAVPTVYLNGEPF
GSGRMTLEEILAKMGNGPDASEFSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTLGIENFISVKRTEGPKLVASLEEHVKDYDIDVMKLQRAKRLEKKELIEVELE
NGAVLKSKSVIISTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFAGKHVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFMPELKADAVLQERLYSLPNVTVLKNVQTKEITGTDTVNGISY
IDRETEEVHHIELQGVFVQIGLVPNTDWLGDTVERVRGEIVIDKHGATNVPGVFAAGDCT
NNPYKQIIISMGSGATAALGAFDYLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatactagatgcagatataaaagcacaactatcccaataccttcaactaatggaaagc
gacatcttacttaaagttagcacaggagacgatgatgtttctaaagatatgttagctcta
gttgatgaattaactgctatgtcatctaagattaaagtcgaaaaagcgcaacttgagaga
acaccaagctttagtgtgaatcgtatcggcgaagaaactggcataacgttcgctggtatt
cctttaggacacgaatttacttcattagtgttagcattacttcaagtaagtggacgtgct
ccaaaagttgaacaaaaagtaattgatcaaataaaaaatattcaaggtgaatatcatttt
gaatcttatatcagcttaagctgtcacaactgtcctgatgttgttcaagctcttaacgta
atgagcgttctaaatcctggtattacacatactatgattgacggcgctgcattcaaagaa
gaagtagaaagcaaagatatcatggcagtaccaactgtttacttaaatggcgaacctttc
ggaagcggtcgtatgacacttgaagaaattttagctaaaatgggtaacggtcctgatgca
tcagaattctctgataaagatccatacgatgttcttgttgttggcggtggcccagctggt
gcaagtgcagcaatttatgcagcacgtaaaggcatccgcacaggtatcgttgcggaacgc
tttggcggtcaagtaatggatacactaggtattgaaaacttcattagcgtaaaacgcacc
gaaggtcctaagctagtagcaagccttgaagagcacgtaaaagattacgatatcgatgta
atgaaattacaacgtgcaaaacgcctagagaagaaagaacttattgaagtggaacttgaa
aatggtgctgttctaaaaagtaagagtgtaatcatttcaacaggtgctcgctggcgtaat
gttggcgtaccaggtgaagctgagttcaaaaacaaaggtgtcgcatactgccctcactgt
gacggtccactatttgctggaaaacacgtagcagttatcggcggcggtaactctggtatt
gaagcagcaatcgacttagcaggtatcgtaaaacacgtaactgttcttgaattcatgcca
gaattaaaagctgatgctgtactgcaagaacgactttacagcttacctaacgtaactgtt
ctgaaaaatgttcaaacaaaagaaattactggtaccgacacagtaaacggcatttcttac
atcgatcgtgaaacagaagaagttcatcatatcgaacttcaaggtgtattcgttcaaatc
ggtcttgtaccaaacacagactggttaggagacactgttgaacgtgttcgcggtgaaatc
gtaattgataaacacggtgctacaaacgtaccaggagtgtttgctgcaggtgactgtaca
aataatccgtacaaacaaattattatttctatgggttcaggagcaactgcagctttaggt
gcttttgattacttaatccgtaactaa

DBGET integrated database retrieval system