KEGG   Bacillus cytotoxicus: Bcer98_0515Help
Entry
Bcer98_0515       CDS       T00560                                 

Definition
(GenBank) Thermolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
bcy  Bacillus cytotoxicus
Brite
KEGG Orthology (KO) [BR:bcy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bcy01002]
    Bcer98_0515
Enzymes [BR:bcy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     Bcer98_0515
Peptidases [BR:bcy01002]
 Metallo Peptidases
  Family M4: thermolysin family
   Bcer98_0515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: ABS20868
UniProt: A7GL60
LinkDB All DBs
Position
590016..591713
Genome map
AA seq 565 aa AA seqDB search
MKKKSLAFVLAAGMAVTTFGGTSSAFADSKNVLSTKKYNEAVKSPEFVAGDLTGATGKKA
ESVVFDYLNAAKGDYKLGNKNAEDSFKIKEVKKDSVTDSTVVRMQQVFEGTPVWGSTQVA
HVSKDGSLKVLSGTVVPDLDKKEKLRNTNKIEEKKAIAIAEQDLGLKPKYEVEPKAHLHV
YQNGDETTYAYVVNLNFLDPQPGNYYYFIEAESGKVLNKYNTLDHVTEESKVPVNQEFTK
QEKGAIKPVTGTNAVGTGTGVLGDKKSINTTLSGSTYYLQDNTRGAQIFTYDAKNRSSLP
GTLWADVDNAFHAKYDAAAVDAHYYAGVTYDYYKNTFNRNSINDAGAALKSTVHYGSNYN
NAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTEYSSNLIYQYESGALNEAISDI
FGTLVEYYDNRNPDWEIGEDIYTPGKAGDALRSMSDPTKYGDPDHYSKRYTGSGDNGGVH
TNSGIINKAAYLLANGGTHYGVTVNGIGKDKVGAIYYRANTQYFTQSTTFSQARAGLVQA
AADLYGANSAEVTAVKQSYDAVGVK
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaagagtttagcttttgtattagcagcagggatggctgtgacgacatttgga
gggacgagctctgcgtttgcagattcaaagaatgtgctctctacgaaaaagtacaatgaa
gccgttaaatcgccagagtttgtagcaggtgatttgactggagcgactggaaagaaagca
gaatctgtcgtgtttgattatttaaatgcggccaaaggggactataagttaggaaataaa
aatgccgaagattcttttaaaattaaagaagtgaaaaaggattcggtaacagattcgaca
gtcgtacgtatgcaacaagtatttgaagggacacctgtatgggggtctactcaagtggct
cacgtaagtaaagatggctcattgaaggtgttgtctggaacggttgtaccagatttagat
aaaaaagagaaattaagaaatacgaataagattgaggagaaaaaagcaattgccattgct
gaacaagacttagggttaaaaccaaaatatgaagtagagcccaaagctcatttacatgtc
tatcaaaatggcgatgaaacaacgtatgcctatgttgtaaatttaaatttcttagatccg
caaccaggaaactattattattttattgaagcagaaagcggtaaagtattaaataaatac
aatacattagatcatgtaactgaagaaagtaaagtaccggttaatcaagagtttacaaaa
caagaaaaaggagctatcaaacctgtaacgggaacgaatgcagttgggacaggtacaggt
gtattaggagataaaaaatcaataaatacgacattatctggatctacgtattatttacaa
gataatacgagaggggcgcaaattttcacatatgatgcgaaaaatcgttcttctttacca
ggaacgttatgggcagatgttgataatgcatttcatgcaaagtatgatgcagcagcagta
gatgctcattattatgcgggcgtcacatatgattactataaaaatacgtttaatcgaaat
tctattaacgatgcaggagctgcgctaaaatcaacagttcattatggaagtaattataat
aatgctttctggaatggttcgcaaatggtatatggagatggtgatggagtaacatttact
tcgttatctggtggaattgatgtaattgggcatgaattgacacatgctgtgacagaatat
agttcgaatttaatctatcaatatgagtcgggtgcattaaacgaagcgatttctgatatt
tttggtacattggtagaatactatgataatcgtaatccagattgggaaattggagaagat
atttatacacctggaaaagccggagatgcacttcgctctatgagtgatccgacaaagtat
ggtgatccagatcattattcgaaacgctacactggttctggtgataatggtggagttcat
acaaacagcggaattattaacaaagcggcttatttattagcaaatggtggcacacattat
ggagtgacagtgaatggtattggcaaggataaagtaggagcaatttactatcgtgcaaat
acgcaatatttcacgcaatcgactacatttagtcaagctcgtgctggtttagtacaagca
gcagctgatttatacggcgcaaattctgcagaggtaacagcggtaaaacaatcatatgac
gcagttggagtaaaataa

DBGET integrated database retrieval system