KEGG   Bacillus cytotoxicus: Bcer98_0808Help
Entry
Bcer98_0808       CDS       T00560                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy00564  Glycerophospholipid metabolism
bcy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bcer98_0808
Enzymes [BR:bcy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Bcer98_0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ABS21146
UniProt: A7GLY8
LinkDB All DBs
Position
924301..925983
Genome map
AA seq 560 aa AA seqDB search
MNFSSKQRKDVLKEVHKQELDLIVIGGGITGSGIALDAVTRGLSTVVFEMQDFAAGTSSR
STKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHKGGTFGAFTTSI
GLRVYDFLAGVKRSERRKMFSREETMKKEPLVKQEGLKGGGYYVEYRTDDARLTIEVMKE
AIEHGAKAVNYAKVDGFLYKDGKVCGVRVIDLLDGKVYEVYGKKIVNAAGPWVDTLREKD
NSKKGKVLQLSKGVHLVIDQKRFPLGQAIYFDTPDGRMVFAIPRGNKTYVGTTDTFYDKD
AAVPKMTTEDRAYIIKAINYMFPTVKITEKDIESSWAGVRPLIYEEGKSASEISRKDEIW
TSDSGLITIAGGKLTGYRKMAEMVVDYVGSLMQKEGHSALPKTKTKHMPISGGHVGGSER
LPAFISKKAGEGTKYGLTTEQAEAFAKFYGSNVDILFNLAKDLKEEAKEYNMPLDVLVPL
VYAMDYEMTVKPVDFFVRRRGAVFFNIHWVYDWKEPVIAYMAAKLGWTNEEKAKYTAELN
QALKDATVPVDEQEQVALAK
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttcaagtaaacaacgtaaagacgtattaaaagaagttcataaacaagagtta
gatttaattgtaattggtggtggtattaccggttctggtatcgcattagatgctgtaacg
cgcggactatcaacagttgtgttcgaaatgcaagactttgcagcaggaacatcaagccgc
tcaacaaaacttgtacatggcggtttacgttatttaaaacaatttgaagtgaagatggta
gcagaagtagggaaagagcgtgcaattgtatatgagaacggtccccatgtaacaacacct
gagtggatgctacttccattccataagggcggtacatttggtgcatttacaacatcaatc
ggtcttcgcgtatatgacttcttagcgggagtaaaacgaagcgaacgtagaaaaatgttt
agccgtgaggaaacaatgaagaaagaaccacttgtaaaacaagaagggttaaaaggcggc
ggttactacgtagagtatcgtacagatgatgctcgtttaacaatcgaagtcatgaaagaa
gcgattgagcatggtgcaaaagctgttaactatgcaaaagtagacggtttcttatataaa
gacggaaaagtatgcggtgtacgtgttattgatttattagatggaaaagtatatgaggtt
tacggcaagaaaattgtaaacgcagcgggtccttgggtagatacacttcgtgaaaaagat
aattcgaaaaaaggaaaagtattacaattatcaaaaggtgttcacttagttatcgaccaa
aaacgttttccgcttggccaagcgatttattttgatacaccagatggacgtatggtcttc
gcgattccacgtggtaataaaacatacgttggtacaacggatacattctatgataaagat
gcagcggtaccaaaaatgacaacagaagatcgtgcatatattattaaagcgattaattac
atgttcccaactgtgaaaattacagaaaaagatattgaatcaagctgggctggtgttcgt
ccgttaatttatgaagaaggtaagagtgcatctgaaatttctcgtaaagatgaaatttgg
acttctgattcagggctaattacaatcgctggtggtaagctaactggatatcgtaaaatg
gcagaaatggttgttgactatgttggatctttaatgcaaaaagaaggtcacagtgcatta
ccaaaaacaaaaacgaaacatatgccaatctctggtggacatgtaggtggttctgaaaga
ttgccagcgttcatttcgaaaaaagcaggagaaggtacgaaatacggtttaacaactgag
caagcagaagcatttgcgaaattctacggctctaacgttgatattctctttaacttagca
aaagatttaaaagaggaagcaaaagaatacaacatgccgttagacgtccttgtaccgctt
gtatacgcgatggactatgaaatgacagtaaaacctgtcgacttctttgtacgtcgcaga
ggagctgtattcttcaatatccactgggtgtatgactggaaagaacctgtcattgcatac
atggcagcaaaactaggctggacaaatgaagaaaaagcaaaatatacagcagaattaaat
caagcattaaaagatgctaccgtgcctgtagatgaacaagaacaagtagcattagcaaaa
taa

DBGET integrated database retrieval system