KEGG   Bacillus cytotoxicus: Bcer98_0856Help
Entry
Bcer98_0856       CDS       T00560                                 

Definition
(GenBank) ComK family protein
  KO
K02250  competence protein ComK
Organism
bcy  Bacillus cytotoxicus
Pathway
bcy02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bcy00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bcer98_0856
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bcy03000]
    Bcer98_0856
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcy02044]
    Bcer98_0856
Transcription factors [BR:bcy03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Bcer98_0856
Secretion system [BR:bcy02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   Bcer98_0856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK
Motif
Other DBs
NCBI-ProteinID: ABS21191
UniProt: A7GM33
LinkDB All DBs
Position
973099..973689
Genome map
AA seq 196 aa AA seqDB search
MDGRAERYVENYVINKKTMALLPVILGEKNVITRVIEVEDSFFMFQKPLDIVERSCRKHG
SSFLGRKEGTKELTRITHKAPIAISPTDQLYFFPTYSYSRKECAWLSHFHIASNKELADG
NLIIRFINGFAVKLEMSKSSFENQQNRTAKLRTEYEDRKDKQGNLQFKPVAKEAISTLRP
AYEKVYLVKEEDIEGE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggatggtagagctgagcgctatgttgaaaattacgtaataaataaaaaaactatggct
ttactgcctgttattttaggggaaaaaaatgtaataacgagagtaattgaagtggaagac
tctttttttatgttccaaaagccgcttgatattgtagaacgaagctgtcgtaagcatgga
tcgagttttttagggaggaaagaaggaaccaaagagttaacacgtattactcataaagca
cctatcgcaattagtcccaccgatcaactttatttctttcccacgtattcctattcaaga
aaagaatgtgcatggctctctcattttcatattgcaagcaataaagagttagcagacggc
aatcttattattcggttcattaatgggtttgcagtgaaattagagatgtcaaagagtagt
tttgagaatcaacaaaaccgtacagcaaagctgagaacagaatatgaagatcgaaaagat
aaacaaggaaacttgcagtttaagccagttgcaaaagaagcgatatcaacgttaagacca
gcgtatgaaaaagtctaccttgtaaaggaagaagatatagaaggagaatga

DBGET integrated database retrieval system