KEGG   Bacillus cytotoxicus: Bcer98_2921Help
Entry
Bcer98_2921       CDS       T00560                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bcy  Bacillus cytotoxicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YqzE
Motif
Other DBs
NCBI-ProteinID: ABS23152
UniProt: A7GSP4
LinkDB All DBs
Position
complement(2983184..2983384)
Genome map
AA seq 66 aa AA seqDB search
MSTNDYVRFVTQQFVSYMDDPKEDRKQKKEQRRAEKAPFLNRWFGMMPLSAALLYQNVKK
KRKKLS
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgtctactaatgattatgtgcgttttgtaacgcaacaatttgtatcttatatggatgat
ccaaaagaggatcgaaaacagaagaaagagcagcgccgtgcagaaaaagcgccgttttta
aacagatggttcggtatgatgccacttagtgccgctttgctttatcaaaatgttaaaaag
aaaagaaaaaaattaagctaa

DBGET integrated database retrieval system