KEGG   Bacillus cereus E33L: BCE33L0281Help
Entry
BCE33L0281        CDS       T00198                                 

Definition
(GenBank) conserved hypothetical protein; possible integral membrane protein
  KO
K07090  uncharacterized protein
Organism
bcz  Bacillus cereus E33L
Brite
KEGG Orthology (KO) [BR:bcz00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BCE33L0281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AAU19957
UniProt: Q63GS1
LinkDB All DBs
Position
330526..331296
Genome map
AA seq 256 aa AA seqDB search
MDELSFQVIILLIAFGFLAAFIDSVVGGGGLISLPALMFVGLPPASAIATNKLAATMGTF
TSAIYFIRSGKVDFKIVGKLIPLTVIGAVAGALVVKFIPPDILRPLVLVMLVFIAIYIIA
KKDWGSVSTYKKMTKRKTLIFFFVILMIGFYDGFFGPGTGSFLIFAFLLIGLDFIQAAAS
GKLLNFVSNIVSLITFLFLDVIHFEYGIIMGLSMIFGAYFGSKFAVQKGVGYVRTLFLLV
TILLISKNVLEYTHIL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggatgaattaagttttcaagtcattattttattaattgcattcggttttttagcagct
tttattgattcagttgttggcggtggaggattaatttcgcttccggcacttatgtttgtt
ggtttaccaccagcttcggcaattgcaacgaataaattagctgcaacgatggggacgttt
acgagtgcgatttactttattcgatcgggaaaggtcgattttaaaattgtaggaaagtta
atcccgttaactgttataggagcggtcgcaggtgctttagtagtaaagtttatcccgccg
gatattttacgtccgttagtgcttgtgatgttggtgtttattgccatttatattattgcg
aaaaaggattggggaagtgtctctacctataagaagatgacgaaaagaaaaacattaata
tttttctttgttattttaatgatagggttttacgatggattttttggaccaggaacagga
tcctttttaatttttgcatttttattaattggtttggattttattcaagcggcagcatct
ggaaaacttttgaattttgttagtaatatcgtatcgttaatcacttttttatttttagac
gtaattcattttgaatacggtattattatggggttatcgatgatttttggcgcttatttt
ggatcgaagtttgcagttcaaaaaggtgttggatatgtaagaactttatttttgttagtg
actattttattgattagcaaaaacgttttggaatatactcatattttgtag

DBGET integrated database retrieval system