KEGG   Bacillus cereus E33L: BCE33L1436Help
Entry
BCE33L1436        CDS       T00198                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bcz  Bacillus cereus E33L
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YppF
Motif
Other DBs
NCBI-ProteinID: AAU18815
UniProt: Q63DH9
LinkDB All DBs
Position
complement(1521403..1521594)
Genome map
AA seq 63 aa AA seqDB search
MVLGDLKQAFSQKKGYYTENVNELLDFARHWYLEGKICISDYRTVIKELEINGATKPTTM
TEA
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atggtattaggggatttaaaacaagcgttttctcaaaaaaaggggtattacacagaaaat
gtaaatgaattgttggactttgcgagacattggtatctcgaaggaaaaatatgcatttca
gattaccgaacagtaataaaagaattagaaataaacggtgcaacaaaacctacaacaatg
acagaagcataa

DBGET integrated database retrieval system