KEGG   Bacillus cereus E33L: BCE33L3621Help
Entry
BCE33L3621        CDS       T00198                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bcz  Bacillus cereus E33L
Brite
KEGG Orthology (KO) [BR:bcz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bcz01001]
    BCE33L3621
Enzymes [BR:bcz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BCE33L3621
Protein kinases [BR:bcz01001]
 Serine/threonine kinases: Other
  Bacterial family
   BCE33L3621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH RIO1 Kinase-like Haspin_kinase Kdo ETRAMP Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AAU16645
UniProt: Q636G4
LinkDB All DBs
Position
complement(3757963..3759936)
Genome map
AA seq 657 aa AA seqDB search
MLIGKRLNDRYKLLKMIGGGGMANVYLAHDDILGRDVAVKILRLDYSNNEEFIKRFHREA
QSVTTLSHPNIVNMYDVGEEDGIYYLVMEYVPGQTLKQYIIERGMLPIGEALDIMEQLTS
AMAHAHHFEIVHRDIKPHNILIRADGVIKVTDFGIATATSATTITHTNSVLGSVHYLSPE
QARGGIANKQSDIYSLGIVMFELLTGRQPFSGESAVAIALKHLQSEIPSPKRWNENIPQS
VENIILKATAKDPFHRYQSANAMKRDIETALYPERINEQPFYIPEDMEATKAIPIIQQEQ
LFENVSDETIVLKGSKVDEQTRKEETDLNKKKKRSNKWLKILITTFLLLAIGITLALTVI
PGFFIPKDVKVPDVSGMKYTTAVNTLVEKGFEVTEPNIVYTDDVEAGDVIKTNPVAGRVV
KENSKITIYQSGGKKKSKMIDFTGKDLESIRTELEEKYKQVTVYYIEDDRPKGAIVEQFP
TSDQMVVEAEQELKIWVSKGPYQIRPGDFSRWTENSVTGYLNERKLTPDIKREYSDTVDK
GLVISQSPKPGTALKEGDKVTIIISEGPKPKVTKTVKVDNISIPYESSIIGEKKPQTIEI
YKEDMQQKMDRPIETRTISESATISLEFVIQEDTKGRYKIVRDGVTIIDKEVPYPTQ
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtgctgattggaaaacgcttaaatgaccgttataagctgctgaaaatgattggtggcggt
ggaatggccaatgtgtatttagctcatgatgatatactgggccgggatgtagcggtaaaa
atattaagactcgactattcaaataacgaagagtttattaaacgtttccatcgagaagcg
cagtctgttacaacgttgtcgcatccaaatattgtgaatatgtatgatgtcggagaagaa
gatggtatatattatcttgtaatggagtatgtaccaggacaaacattgaagcaatacata
attgagcgagggatgttacctataggagaagctcttgatattatggagcagttaacatcc
gccatggcacatgcccatcattttgaaattgtgcaccgtgatattaaaccgcacaatatt
ttaattcgagctgatggagtaataaaagtaacagattttggaattgcgacagctacaagt
gcaacaacaattacacatacaaattcagtactcggttcggtgcattacttatcaccagaa
caagcacgcggcgggatagcaaataaacaatcagatatttattccctagggattgttatg
tttgagttgttaacaggaagacaaccgttttctggcgaatctgctgttgctatagcttta
aaacatttacaaagtgaaattccgtctccaaaaagatggaatgaaaatattccgcaaagt
gtcgaaaatattatattaaaggcaactgcgaaagatccgtttcatcgatatcaatctgcc
aatgcgatgaaacgagatattgaaactgcactatatccagagaggataaatgagcagcca
ttttacataccggaagatatggaagcgacaaaagcgattcccattattcaacaagaacaa
ttatttgaaaatgtaagtgatgaaacgattgttttaaaaggaagtaaagtggatgaacag
acaagaaaagaagaaaccgatttaaataagaagaaaaaacgaagtaataaatggctcaag
attttaattacaacatttttacttttagcaatcggaataacgttagcgcttactgttatt
ccaggattctttattccaaaagatgtaaaagtccctgatgtgtctggtatgaaatatacg
acagcagtaaatacattagttgaaaagggttttgaggttacggaacctaatattgtatat
acagatgatgtggaagcaggagatgtaataaaaactaatcctgtagcaggtagagtagtg
aaagaaaactctaaaattactatctatcaatcaggtgggaaaaagaaaagtaagatgatt
gatttcacaggaaaagatttagagagtataagaacagagttagaagagaaatataaacaa
gttacagtatattatattgaagatgataggccaaaaggtgcaattgtagagcaatttccg
acgtctgaccaaatggtggtagaggccgagcaggaactgaaaatctgggtaagtaaaggc
ccttatcaaattagaccgggtgatttttcaaggtggactgaaaatagtgtaactggttat
ttgaatgagagaaaactaactccagatataaaacgagagtattccgatactgttgataaa
ggacttgtaatttcgcaatctccaaaaccgggaacggcgttaaaagaaggagataaagtg
acgattatcatctcagagggccctaagccgaaagtaacgaaaaccgtgaaagtggataat
atttctattccgtatgagtcttctataataggtgagaaaaaaccgcaaacgatagaaatt
tataaagaagatatgcaacaaaaaatggatagaccaattgaaactagaacaatttcagag
tcggcaactatttcattagaatttgtaattcaagaagatacaaaaggacgctataaaatt
gtaagagatggtgtaacgattattgacaaagaagtaccatatccaacacaataa

DBGET integrated database retrieval system