KEGG   Bdellovibrio sp. NC01: DOE51_14280Help
Entry
DOE51_14280       CDS       T06360                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bdc  Bdellovibrio sp. NC01
Brite
KEGG Orthology (KO) [BR:bdc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DOE51_14280 (ahpF)
Enzymes [BR:bdc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DOE51_14280 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 HI0933_like Thioredoxin_3 FAD_oxidored FAD_binding_3 DAO AlaDh_PNT_C Thi4 NAD_binding_8 Spermine_synth Lycopene_cycl Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: QDK38668
UniProt: A0A514WYT4
LinkDB All DBs
Position
2970212..2971786
Genome map
AA seq 524 aa AA seqDB search
MSLDSSLKEQLTSVFAALDKPVELVYENSAHEDQKDLIDMLQDVASTSSQIVLRKNDTGT
SPMPQFHINYEGKHTGIIFKGIPGGHEFTSLILAILNTNRKGKLLDSVIVDRVKRLNKNI
TVQSYISLTCENCPEVVQALNQMALVHGSMKHEIIDGGYVQDDIQKLGIQGVPSLVADSK
MFHSGRISLLDLLAKLEKTFGVDENAAPSEPVNKNLGHFDVLVIGGGPAGASAAIYSVRK
GLSTAMITEKIGGQVQETKGIENLISVTYTEGPQLAAQLNQHVASYPIRVFENRRVKKVH
TDKVKAIELESGEHLTADSIIVTTGAKWRELGVEGEKDYLGRGVAYCPHCDGPFYKGKKV
AVIGGGNSGVEAAIDLAGIVREVVVFEYNDTLKADQILVDKLKSLPNCSIITNARTEKVL
GDGNKVQQIEYTDRSLNTTEKMDLDGIFVQIGLVPNSQFLKDTVNLSKFGEIIVDEKGRT
SIQGIYAAGDVTTTPYKQIVIAMGEGAKAALAAFEDRIYSNAQH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtcattagactcttctcttaaagaacaacttacctcggtcttcgcagctcttgataaa
cccgtagaacttgtttacgaaaacagcgctcatgaagatcaaaaagatcttatcgacatg
cttcaagatgttgctagcacatcttcgcaaatcgttttgcgtaaaaacgatactggcaca
agccctatgccacaatttcatattaactatgagggcaaacacacaggcatcattttcaaa
gggattcctggcggtcacgaattcacttcattaattcttgcgatcttgaatacaaaccgt
aaaggtaagcttcttgatagcgtgatcgtggatcgcgtaaaacgtttaaataaaaatatc
acggttcaatcttacatctctttgacatgcgaaaactgtcctgaagttgtacaagctttg
aatcaaatggctttagttcacggtagcatgaaacacgaaatcatcgacggtggttacgta
caagacgatattcaaaaactgggtatccaaggtgtaccaagcttagttgctgattctaaa
atgttccattcgggtcgtatttcactattggatcttctagctaagctagaaaaaacattc
ggtgttgatgaaaatgcggcaccttctgaacctgtgaacaaaaacttgggtcactttgac
gtcttggttatcggtggtggccctgcgggtgcatcggctgcgatctatagcgtgcgtaaa
ggtttgtcgacagcaatgatcactgaaaaaatcggtggccaagtgcaagaaacaaaaggt
atcgaaaacttgatctctgtcacttatacagagggtcctcaattggcagcgcaattgaat
caacacgtggcaagctatccgattcgtgtgtttgaaaatcgccgagttaaaaaagttcac
actgacaaagtaaaagcgattgaacttgaaagtggtgagcatctgacagcagattccatc
atcgttacaacgggcgctaaatggcgcgagttgggtgttgaaggtgaaaaagattatctc
ggtcgcggcgttgcttactgcccgcactgtgacggccctttctataaaggaaaaaaagtt
gcggttatcggtggtggtaactcaggcgttgaagcagcgatcgaccttgcgggtatcgtg
cgtgaagttgtggtttttgaatacaacgacactttgaaagcagatcagatcttagtcgat
aaactaaaatctctaccgaactgctcgatcattacaaatgcacgaactgagaaagttttg
ggcgatggtaataaggttcagcagatcgagtacacagatcgctctttgaataccacagag
aaaatggatctagacggtatcttcgtacaaatcggcttggtaccgaacagccagttttta
aaagacactgttaacttgtcaaaatttggtgagatcatagtggatgagaaaggtcgcaca
tcgatccaaggcatttatgctgcgggtgatgttacgacaactccgtacaagcaaattgtg
atcgcgatgggtgaaggggcgaaagccgccctggcagcattcgaagatcgcatttactcg
aacgctcaacattaa

DBGET integrated database retrieval system