KEGG   Bifidobacterium dentium Bd1: BDP_0392Help
Entry
BDP_0392          CDS       T01143                                 

Definition
(GenBank) Solute binding protein of ABC transporter system
  KO
K02077  zinc/manganese transport system substrate-binding protein
Organism
bde  Bifidobacterium dentium Bd1
Brite
KEGG Orthology (KO) [BR:bde00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bde02000]
    BDP_0392
Transporters [BR:bde02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Putative zinc/manganese transporter
    BDP_0392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ZnuA PucR MGS
Motif
Other DBs
NCBI-ProteinID: ADB09069
UniProt: D2Q8D3
LinkDB All DBs
Position
485297..486202
Genome map
AA seq 301 aa AA seqDB search
MKRMVQRAVSVVAAITMLSALGACGGGQSANGSDEDAINVVASVNQWGTVAKALGGGNVN
VTSIINSTNVEAHDYEPTTADIAKLQKAQVIVVNGADYDSWAVKAAKSTKANVVNAAEVS
GKKSGDNPHVWFSAQVREDTAKAITAAYKKAVPSKADDFDKLYEQWQSKENDLAKSIAEV
KKTADGLTYAATESVADYLASDLGLKDVTPTGYAQATANESEPTPTDIKQFTDALESGEI
KLLVVNTQEETDLTGKITDAAKSANVPMVELTEQMPDKYDSLTAWMEGLIDEFSAAIQQA
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtatggtacaaagggcggtctcggtggttgcggcgatcaccatgctttcggca
ttgggtgcgtgcggcggcggtcagtccgcgaatggttccgatgaggacgccatcaacgtg
gtggcctccgtcaatcaatggggcaccgtggcgaaggccttgggcggtggcaacgtcaac
gtgaccagcatcatcaattccacgaatgtggaagcgcacgactatgaaccgaccaccgcg
gacatcgccaagttgcagaaggcgcaggtgatcgtcgtcaacggcgccgactatgactcg
tgggccgtgaaggcggcgaagtccaccaaggcgaacgtcgtcaacgcggccgaggtgagt
ggcaagaagagcggcgataaccctcatgtctggttctccgcgcaagtgcgcgaagacacg
gccaaggcgatcaccgcggcctacaagaaggccgttccgagcaaggccgatgatttcgac
aagctgtatgagcaatggcagtccaaggagaacgatctcgccaagagcatcgccgaggtc
aagaaaaccgctgatgggctgacctatgcggcgactgaatccgtggccgattatctggcg
agtgaccttgggctgaaggacgtgacgccgaccggttatgcacaggccaccgccaatgaa
agcgaaccgacgccaaccgacatcaagcagttcaccgacgcattggaatccggtgagatc
aaactactggtcgtcaatacacaggaggagaccgatctgaccggcaagatcacggacgcg
gcgaagtccgcgaacgtgccgatggtggaactcaccgaacagatgccggacaagtatgat
tcgctgactgcgtggatggagggtctgatcgacgaattcagcgcggccattcagcaggcg
ggctga

DBGET integrated database retrieval system