KEGG   Bifidobacterium dentium Bd1: BDP_0398Help
Entry
BDP_0398          CDS       T01143                                 

Definition
(GenBank) DNA and RNA helicase related protein
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTES_1575
Motif
Other DBs
NCBI-ProteinID: ADB09075
UniProt: D2Q8D9
LinkDB All DBs
Position
492438..496061
Genome map
AA seq 1207 aa AA seqDB search
MSESNERSTTALDRIRGWREQYRLGLSPSPLEDVTQLTAQLDLTHAHPSGIAQLFASGHV
TLDSLFRDNGMLRAAGRRVERVIDDRETKSRISGVGELSLVVGVATWKGNQVPVLMYPVE
VRRTGKTAESGTTIAFTGRVRLNASFAAVMREHNVALDEAKLFDGSNYESGTPETSAVFS
AITARATSAFPDFEIERHIILGCFMDPSTQMLVESQKIIDQLAQGPTGNTVLDALAGDKA
ARDALNNADIAEYSPFDGDPHGEYEVGDVSNTVRYAAQIAASGHSLFVDSSIGNNTAEQA
AAIASRCVMSGRSVLYVPCVTNQRRRFAQAINANEMGGQLLDIADDGANAAIDRQLIAAV
GFQSGVATSRFDQLADELVGVRSRLTRYLGDLHGVSQEWGVSAYQTIQNLAQIAVLPTRP
TTHVRLSKQAAHAISDKMEDWAVKMQRAGELGEYSITEKDTAWFKASIYSEEEAVSAHQR
VVELLRKVLPATREQVASTVQTCGFPIPTTAQEWGRQVMVLKNLRRVLDVFQPEIFERDI
VSMIEATKPKAERKAEGSSMGFWERRRHIKEAKGLLRVGAQVENLHDALQVVAKQSEQWH
MFVPHGGWPVLPAKLDDILETQDELTRDMTALNTILATTPMGGSLETVDFNQVEERLKAL
YDDHQSLDTLPERARLEREFHDIGLDELVEDLRNRGIDDNAVAGELQLAWWTTVFEDIVR
SSAIISNQDGSALQAAADRFAQVDVEHVRSVGPMVAQESMRRLCDMLFSRTQEANLLHTT
LAGSRSVSLNRLHKEHAQILAAAKPILMATPATLAAVTDPAPLADVVIVDAGAHIPSVEL
MSIVCRAQQVVVIAHRETVTSDSVRSLIALLPSVKIADRPVRRAPKLGAFLESEGYGSLS
LDVAREGSQGEVAYHYIEEANGVPVMTSGLVESSQQEIDEVVRIITQRAASFTIVPASYT
LTVVALTHTFRTRLGAELKAMATKNKAMGLFLRHVRIVDITDVAGAHTTDAIVAMCYAKT
SHGRLLQQFGALEAEGGRGMLLDALAVADRHVDIVSAFSSTDMDDERLHQSGPKMLKTVL
RWAEQLDDRPVRPSENESGTNILFNDLADRIRARGLKVAVDYGFDRGTRLPLVVGLPDKP
FSLAVLTDDAQFMGLQSTRQRHRVLLQDIESLGWSVMTVWSVGAFVNPDKEVDRIVARLS
DIYQEGK
NT seq 3624 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaagcaatgagcggtccaccactgcgctggaccgcattcgcggctggcgtgag
cagtaccgtctgggattgtcgccttccccgcttgaagacgtgacgcaactgaccgcgcag
ctggacctgacgcatgcccacccctccggcatcgcgcaactgttcgccagcgggcatgtc
acgttggattcgctgtttcgcgacaacggcatgctgcgtgcggccggccgccgcgtggaa
cgcgtgattgacgatcgtgagacgaaaagccgtatcagcggtgtgggcgaactgtcgctg
gtcgtgggcgtggccacatggaagggcaatcaggtaccggtgctcatgtacccggtcgaa
gtgcgccggaccggcaaaaccgccgaaagcggcaccaccatcgcctttaccggccgcgta
cgcctgaacgcctccttcgccgccgtcatgcgtgaacataacgttgcccttgatgaggcc
aagctgttcgatggctccaactacgagagcggcactcccgaaacctcggcggtgttctcc
gccatcaccgcgcgcgcgacttcggcattcccggatttcgagattgagcgtcatatcatt
ctcggatgcttcatggatccgtccacacagatgctggtggaaagccagaagatcatcgac
cagttggcgcagggacctaccggcaataccgtgctggacgcgctcgcaggagacaaggcc
gcccgtgacgcgctgaacaatgccgatatcgccgaatacagcccgtttgatggcgatccg
cacggtgaatatgaggtcggcgatgtcagcaacaccgttcgctacgccgcacagattgcc
gcttccgggcattcgctgttcgttgacagttccatcggcaacaacacagccgaacaggcc
gcagccatcgcctcgcgttgcgtgatgagcggccggtccgtgctgtatgtgccgtgcgtc
accaatcagcggcgtcgttttgcgcaggccatcaacgccaatgagatgggcgggcaactg
ctcgacatcgccgacgacggcgccaacgcggccatcgaccgccagctgattgcggcggtc
ggattccagtcgggcgtcgccacctctcgtttcgatcagttggcggacgaactggtgggc
gtacgttcccgcctgacccgatacttgggcgatctgcacggggtcagccaggaatggggc
gtttccgcctaccagaccattcagaacctggcacagatcgccgtgttgcccacgcgtccg
accacgcatgtgcgcctgagcaagcaggctgcccacgccatcagcgacaagatggaggat
tgggccgtcaagatgcagcgcgccggcgaacttggcgaatattcgatcaccgaaaaggac
accgcctggttcaaggcctccatctattccgaggaagaggccgtcagtgctcatcagcgc
gtggtcgaactgctgcgcaaggtgcttcccgccacccgtgaacaggtggccagcaccgtg
cagacctgtggtttcccgattccgaccaccgcgcaggagtggggccgccaggtcatggtg
ctcaagaatctgcgccgcgtgcttgacgtgttccagccggagatcttcgaacgtgacatc
gtctccatgatcgaggccaccaagccgaaggccgagcgcaaggccgaaggcagctccatg
ggattctgggagcgccgccgccatatcaaggaagccaagggcctgctacgtgtcggcgca
caggtggagaacctgcatgacgccttgcaggtggtggccaagcagtcggaacagtggcac
atgttcgtgccgcacggtggttggccggtgctgcccgccaagcttgacgacattttggaa
acccaggacgagctgacccgcgatatgacggccctgaatacgattctggccaccacgccg
atgggcggcagcttggagaccgtggacttcaatcaggtcgaggagcgtctcaaagccctg
tacgacgatcatcagtcgcttgacaccctgccggagcgtgcccgtctggaacgtgaattc
catgacatcgggcttgacgagttggtggaggatctacgcaatcgcggcatcgacgacaat
gccgtggccggcgaactgcagctggcttggtggaccacggtgttcgaagacatcgtgcgt
tcctccgcgatcatctccaaccaggacggttcggctctgcaggccgcagcggatcgattc
gcccaggtggatgtggagcatgtgcgctccgtcgggcccatggtggcgcaggaatccatg
cgccggctgtgcgacatgctgttctcccgcacgcaggaggccaatctgctgcataccacg
cttgccggttcccgcagcgtgtcgttgaatcgcctgcacaaggagcatgcccagatcctc
gccgcggccaagccgattctcatggccaccccagccacgcttgccgcggtcaccgatccc
gctcctcttgccgatgtggtgatcgtcgatgcgggtgcgcatattccgtccgtggaattg
atgagcatcgtctgccgtgcgcagcaggtcgtggtgatcgcgcatcgcgaaaccgtcacc
tccgacagcgtacggtcgctgatcgcactgctgccgagtgtgaagatcgccgaccgtccg
gttcgtcgtgcgccgaaactcggtgccttcctcgaatccgaaggttatggatcgctgtcg
cttgacgtggctcgtgagggttctcagggcgaagtcgcctaccattacatcgaagaggcc
aacggcgtgcccgtcatgacctccggactggtggagagcagccagcaggagatcgacgaa
gtggttcgcatcatcacgcagcgtgccgcctcgttcaccatcgtgcccgcctcctacacc
ctgacggtggtggcgctcacccatacgttccgtacccgattgggggccgagctcaaggcg
atggccaccaagaacaaggcgatgggactgttcctgcgccatgtacgtatcgtggacatc
accgatgtcgccggagcccacaccaccgacgccatagtggcgatgtgctatgcgaagacc
tcgcatggccgcctgttgcagcagttcggtgcgcttgaagccgaaggcggccgcggcatg
ttattggatgcgctggccgttgccgatcgtcatgtcgatatcgtctccgcattctcctcg
acggacatggatgacgagcgcctgcaccaatccggtccgaagatgctcaagaccgtgctg
cgctgggccgagcagcttgacgatcgtccggtacgcccgtcggagaacgagtccggcacc
aacatcctgttcaacgacttggccgaccgtattcgtgcccgtggcctgaaggtcgccgtc
gattacggattcgatcgcggtaccaggctgccgctggtcgtgggattgcccgacaagccg
ttctcgttggccgtgctgaccgatgatgcccagttcatgggactgcagtccaccaggcaa
cgccaccgcgtactgttgcaggacatcgaatcgttgggatggtccgtgatgaccgtgtgg
agcgtcggcgcgttcgtcaatcccgataaggaagtcgaccgtatcgtggcgcgtctgagc
gatatctaccaggagggcaagtga

DBGET integrated database retrieval system