KEGG   Bifidobacterium dentium Bd1: BDP_0401Help
Entry
BDP_0401          CDS       T01143                                 

Definition
(GenBank) Hypothetical protein
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn-ribbon_8 HypA Prok-RING_1 NOB1_Zn_bind Zn_Tnp_IS1595 zf-ribbon_3 PhnA_Zn_Ribbon zinc_ribbon_2 DUF1178 NRDD DZR TFIIS_C A2L_zn_ribbon zf-C2H2 Rubredoxin_2 zinc-ribbons_6 zf_C2H2_10
Motif
Other DBs
NCBI-ProteinID: ADB09078
UniProt: D2Q8E2
LinkDB All DBs
Position
complement(497143..497325)
Genome map
AA seq 60 aa AA seqDB search
MPTYHYRCKNCNYDFTEQQSFSDDPITVCPKCGEEQVRKVYSAVPIEFKGSGFYRTDKSK
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
ttgcctacctatcattaccgttgcaagaactgcaattacgatttcaccgaacagcagtcg
ttcagcgacgacccgattaccgtgtgcccgaagtgcggcgaggagcaggtgcgtaaggtc
tattccgccgttccgatcgaattcaagggttccggcttctaccgcacggataaatccaag
tag

DBGET integrated database retrieval system