KEGG   Bifidobacterium dentium Bd1: BDP_0404Help
Entry
BDP_0404          CDS       T01143                                 

Definition
(GenBank) Narrowly conserved hypothetical membrane spanning protein
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_holin_3_6 DUF3754 DUF3147 Halogen_Hydrol FA_desaturase DUF2207 Phlebovirus_G1
Motif
Other DBs
NCBI-ProteinID: ADB09081
UniProt: D2Q8E5
LinkDB All DBs
Position
498884..500083
Genome map
AA seq 399 aa AA seqDB search
MGYESLSTVVVLAIVVILMVGWLPRRTVKGMKRVIEHREDRFSPSLHLVDADSGTRFSDV
STPQAKGAIMQSSEAQGGRMSEEHIAQVRTLRRAAIRRRRIIVVALAVTTIAVIVAAVAL
HFSAWFALIPAVMLVAVMALGVRAAKQARDWEQKVARYRSRMRKQAAAERERARAEQAER
RRLHDAELAEARRIAETQVPTDVMPEGEIRQAVERGKADRDRALNKRKQEAAAKVEVAPE
ATPDRRNAGLSIHDERDKQQDMAEHAEDKPVSKEISVPDQSSQDLISFSLGAPRNGVEVR
QAVPESMEIKSTRQVAKAIPPVRPVEQAEPVEPLIVPSDAMSDMDEDESGARVEAGVQLN
EVSVKDFHDTEVSAEVTAPDATSDSLGTGLEAILARRGA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgggttatgagtcgttaagcacggtggtcgtgcttgcgattgtcgtgattctcatggtt
ggatggctgccccgacggacggtcaaaggcatgaagcgagtgatcgaacatcgcgaagac
cggttttcgccgtcgttgcatcttgtggatgccgatagcgggacgaggttctccgacgtg
agcacgccgcaggcgaaaggggctataatgcagtcttccgaggctcaggggggcaggatg
tccgaagagcatatcgcccaagtgcgcacccttcgccgagctgcgatccggcgacgtcga
atcatcgtcgttgcgctggccgtgacgacgattgcggtgatcgtcgcagcggttgcgttg
catttcagcgcatggttcgcgcttattccggcggtcatgctggttgcggtgatggccctt
ggcgtgcgtgccgccaagcaggcgagggattgggagcagaaagtcgcccgatatcgttcc
cggatgaggaagcaggccgccgccgaacgtgagcgtgcgcgtgccgagcaggcggaacgt
aggagactgcatgatgcggaactggccgaagcgcgcaggattgccgaaacgcaggttccg
accgatgtgatgccggaaggggagattcgccaggccgtcgaacgcggcaaggcggaccgt
gatcgtgcgttgaacaagcgcaagcaggaggccgcggcgaaggtcgaggttgcgccggaa
gccactccggaccggcggaacgccggtctgtccattcatgacgaacgtgacaagcagcag
gatatggctgaacatgccgaggacaagccggtttccaaggagatttccgtaccggaccaa
tcctcacaggatttgatttcgttctcgctgggagctccgcgcaacggtgtggaggtcagg
caggcagtgccggaaagcatggaaatcaagtccaccaggcaggtcgccaaggccataccg
ccggtcaggccggttgagcaggccgaacccgtcgaaccgttgatcgtgccttccgatgcc
atgagcgacatggatgaagatgagagcggggcgcgtgtcgaggctggcgtgcagctcaac
gaggtcagtgtcaaggactttcatgatacggaggtcagtgccgaggtgacggctcccgat
gccacctccgattcgcttggcaccggtttggaagccattctggcccgtcgtggcgcgtga

DBGET integrated database retrieval system