KEGG   Bifidobacterium dentium Bd1: BDP_0405Help
Entry
BDP_0405          CDS       T01143                                 

Gene name
hsp10
Definition
(GenBank) Hsp10 10 kDa chaperonin GROES
  KO
K04078  chaperonin GroES
Organism
bde  Bifidobacterium dentium Bd1
Brite
KEGG Orthology (KO) [BR:bde00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bde03110]
    BDP_0405 (hsp10)
   03029 Mitochondrial biogenesis [BR:bde03029]
    BDP_0405 (hsp10)
Chaperones and folding catalysts [BR:bde03110]
 Heat shock proteins
  HSP10
   BDP_0405 (hsp10)
Mitochondrial biogenesis [BR:bde03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    BDP_0405 (hsp10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn10
Motif
Other DBs
NCBI-ProteinID: ADB09082
UniProt: D2Q8E6
LinkDB All DBs
Position
500300..500593
Genome map
AA seq 97 aa AA seqDB search
MSISLTPLEDKIIVKQAEAETQTASGLFIPDNAKEKPQQGEVLAVGPGRRNDAGERIPVD
VKVGDKVLYSKYGGTEVHYQGEDYLIVAARDILAILG
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgatctcactcacaccgttggaagacaagatcatcgtcaagcaggcggaagccgag
acccagaccgcttccggtctgttcatcccggacaacgccaaggagaagccgcagcagggc
gaagtcctggccgtcggcccgggccgtcgtaacgacgccggcgagcgcattccggtcgac
gtcaaggtcggcgacaaggtgctgtactccaagtacggtggcaccgaagtgcactatcag
ggtgaggattacctcatcgtggccgcccgcgatattctggccatcctcggctga

DBGET integrated database retrieval system