KEGG   Bifidobacterium dentium Bd1: BDP_0406Help
Entry
BDP_0406          CDS       T01143                                 

Gene name
metB
Definition
(GenBank) metB Cystathionine gamma-synthase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde00270  Cysteine and methionine metabolism
bde00450  Selenocompound metabolism
bde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BDP_0406 (metB)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BDP_0406 (metB)
Enzymes [BR:bde01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     BDP_0406 (metB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Met_gamma_lyase DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADB09083
UniProt: D2Q8E7
LinkDB All DBs
Position
complement(500699..501943)
Genome map
AA seq 414 aa AA seqDB search
MTSELVHHGQSFDDQPLGFGTKSIHLGNGVDKETGAIRRPITLANAYALPYDPSDINWSS
SDVNLYTRNGHPNQRYLEAKLANLEGAEDAVVLASGVAALAATFTTFLNRGDHAIFSDTT
YIAAYRLLNQILPEKYGIETSIVDTSDPANVLNAIKPNTKLVHLETPANPTLKVTDIASV
TSIAREAQERLGHDILVSVDNTFNSPYNVRPLELGADIVVESLTKYINGHGDALGGMIAT
TKARTDEIRFTAQVNYGGIISPFNAWLINRGTVTLPLRMKQHNASAQAIAEHLERIDAVR
FVSYPGLESHPGHTVATSQKAHPAAGYGGVLAFGLNTDHEGHNRFVSKLNVITSAVSLGH
DESLIVFLGEDDERQYLYPQEFHQGFFRLAVGLEDTDDLIRDIDHALTEAGLME
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagaactcgtacaccacggacaatcattcgacgaccagccgctcggcttcggc
accaaatccatccacctcggcaacggcgtggacaaggagaccggagcgatccgacggccg
atcaccctggccaacgcctacgcactgccctacgacccgagcgacatcaactggtcaagc
tcggacgtgaacctctatacgcgcaacggacacccgaaccagcgttatctcgaggcgaaa
ctcgccaatctcgaaggagccgaggacgccgtcgtgctcgcctcaggcgtggccgcactc
gccgccaccttcaccaccttcctcaaccggggcgaccatgcaatcttctccgacacgaca
tacatcgccgcataccggctcctcaaccagattctgcccgagaagtacggcatcgaaacc
tccatcgtcgacacctccgacccggccaacgtactcaacgccatcaagccgaacaccaag
ctggttcatctggagacgccagccaacccgaccctgaaggtcaccgacatagcgagcgtg
acgtcaatcgcccgcgaggcgcaggaacggcttggccatgacatcctcgtcagcgtggac
aacaccttcaattcgccgtacaacgtacgcccgctggaactcggcgcggacatcgtggtg
gagagcctcaccaaatacatcaacggccatggagacgccctcggcggcatgatagccacc
accaaggcccgaaccgacgaaatccgcttcaccgcccaggtcaactacggcggcatcatc
agcccgttcaacgcatggctgatcaaccgaggcacggtaacgctcccgctgcgcatgaag
cagcacaacgcctcggcacaggccatcgccgaacatctcgaacggatcgacgcggtacgg
ttcgtcagctatccgggactcgaatcacacccgggacacaccgtggcaaccagccagaag
gcccacccggcggccggatacggcggcgtactcgccttcgggctcaatacggaccacgaa
ggccacaaccggttcgtctccaagctcaacgtcatcacctcggcggtctcgctcggacat
gacgagagcctgatcgtgttcctcggagaggacgacgaacgccaatacctgtacccgcag
gagttccatcagggcttcttccgccttgcagtcggactcgaagacaccgacgatctgatc
cgagacatcgaccacgcactcacggaagccggattgatggaatag

DBGET integrated database retrieval system