KEGG   Bifidobacterium dentium Bd1: BDP_0442Help
Entry
BDP_0442          CDS       T01143                                 

Gene name
rplX
Definition
(GenBank) rplX 50S ribosomal protein L24
  KO
K02895  large subunit ribosomal protein L24
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bde00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BDP_0442 (rplX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bde03011]
    BDP_0442 (rplX)
Ribosome [BR:bde03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BDP_0442 (rplX)
  Bacteria
    BDP_0442 (rplX)
  Archaea
    BDP_0442 (rplX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ribosomal_L24 KOW DUF3320 ComGG
Motif
Other DBs
NCBI-ProteinID: ADB09117
UniProt: D2Q8I1
LinkDB All DBs
Position
533714..534049
Genome map
AA seq 111 aa AA seqDB search
MVAKIKSGDLVKVIRGKDRGKEGTVKQVLKDDRLIVEGVQIVKKHVRATQQGQQAGIVAV
EAPIHRSNVMVIDPETKQPTRVGVIVKEEARDGKVKTVRVRVAKKSGKELA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggtagccaagatcaagagcggcgacctggtcaaggtcatccgcggcaaggaccgcggc
aaggaaggcaccgtcaagcaggtgctcaaggacgaccgtctgatcgtcgaaggcgtgcag
atcgtcaagaagcacgtgcgcgccacgcagcagggccagcaggccggcatcgtggctgtc
gaggctccgattcatcgctccaatgtgatggtcatcgatccggagaccaagcagccgacc
cgcgtgggcgtcatcgtgaaggaagaggctcgtgacggcaaggtgaagaccgtgcgcgtg
cgtgtcgccaagaagtccggaaaggagctggcatga

DBGET integrated database retrieval system