KEGG   Bifidobacterium dentium Bd1: BDP_0449Help
Entry
BDP_0449          CDS       T01143                                 

Gene name
rpmD
Definition
(GenBank) rpmD 50S ribosomal protein L30
  KO
K02907  large subunit ribosomal protein L30
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bde00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BDP_0449 (rpmD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bde03011]
    BDP_0449 (rpmD)
Ribosome [BR:bde03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BDP_0449 (rpmD)
  Bacteria
    BDP_0449 (rpmD)
  Archaea
    BDP_0449 (rpmD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L30
Motif
Other DBs
NCBI-ProteinID: ADB09124
UniProt: D2Q8I8
LinkDB All DBs
Position
536943..537128
Genome map
AA seq 61 aa AA seqDB search
MMTNLNIKLHHGLVNSTPKQRAAAQTLGLNKIGKTVTREDTPALRGQLLVLRHLITVEEA
D
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
gtgatgactaacctgaacatcaagctgcaccacggtctggtgaactccactccgaagcag
cgtgctgcggctcagactctgggcctgaacaagattggcaagaccgtgacccgcgaggat
actccggcccttcgtggccagctgctcgtgttgcgtcacctgatcaccgttgaggaggct
gactga

DBGET integrated database retrieval system