KEGG   Bifidobacterium dentium Bd1: BDP_0480Help
Entry
BDP_0480          CDS       T01143                                 

Definition
(GenBank) Putative response regulator of two-component system
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg LytTR B12-binding DUF5609
Motif
Other DBs
NCBI-ProteinID: ADB09154
UniProt: D2Q8L8
LinkDB All DBs
Position
complement(567354..568151)
Genome map
AA seq 265 aa AA seqDB search
MMRVAIVEDHPAERQLVKTMCTAYFRDKHDLDIDCGTFTGTDDFIESWKSNRFDLVLLDC
YLTDDETDATAPTGLDIARFLRRQRDDCPIVFITSSSDFAVLGYEVQATGYILKPISRAN
FDATMDRAYETLSERPRVTHLSTDKPSHAADAAWQVAFGNPAINMDRRLIVYCLSNAHYV
EFTFADGTCSKIRTNFSDVERRLTVFDNFYRTARGVLVNFDYVTGISNAEFVMKGGKRIP
ITKTAVTTTCRKYAEYTFTRMRSEQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcgtcgcaatcgtcgaggaccatcctgccgaacgacagctggtaaagaccatg
tgcaccgcctattttcgggacaagcacgatcttgacattgactgcggcaccttcaccggc
accgacgatttcatcgagagctggaaatccaaccgtttcgacctggtgctgctcgactgt
tacctgaccgacgacgaaaccgacgcgacggcaccgaccggcctggacatcgcacgcttc
ctgcgacggcaacgcgatgactgccccatcgtcttcatcacatccagcagtgacttcgcc
gtgctcggctatgaggtgcaggcgacaggctatatattgaaaccgatcagccgcgccaat
ttcgacgcgaccatggatcgcgcctacgaaaccctgagcgaaagaccacgcgtcacgcat
ctgtcgacggacaaaccgtcgcatgccgccgatgcggcctggcaggtggcattcggcaat
cccgcaatcaacatggatcgccgtctcatcgtctactgcctgtccaacgcgcattatgtg
gagttcacgttcgccgatggcacctgcagcaagatccgcacgaacttctccgacgtggag
cggcgtctcaccgtcttcgacaacttctaccgcaccgcacgcggggtattggtgaacttc
gactacgtgaccggcatcagcaacgccgaattcgtgatgaagggcggcaagcgcattccc
atcaccaaaaccgcggtgaccaccacctgccgcaaatacgcggaatacacgttcacccgc
atgagatcggagcagtga

DBGET integrated database retrieval system