KEGG   Bifidobacterium dentium Bd1: BDP_0493Help
Entry
BDP_0493          CDS       T01143                                 

Definition
(GenBank) hypothetical protein
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF218
Motif
Other DBs
NCBI-ProteinID: ADB09166
UniProt: D2Q8N0
LinkDB All DBs
Position
583988..585028
Genome map
AA seq 346 aa AA seqDB search
MLSLGYCILGVMLCIATFFLAKKHPNRISNGFILELAVILLLESLLGLMAAHMGASPWLM
GVAYVLAYIRPVLFVILGFALLVNGIIGVRREGFSLTSALPFAWGIMLLFSGYWFLWGPG
QGMSGSEFYVRVMTFVSMMVNYIPIALFGVWFSNDICYKSGKAPETEYIIVLGCSILDDG
TVTPLLRGRLDAAIAAWEQGGRRATIITSGGQGHDEVISESRAMANYLLSQGVPESSILL
EDKSSTTEENLKFSHAIMDARGGAAHCTIATSSYHCLRAAMFARRLGINASCVGGHTAAF
FYPAAFFREYIALIMRNRPAVIIFFGLVVVRFALMLMDIVPEGVFF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgctgagtcttggctactgcatcttgggcgtcatgctctgcattgccaccttttttctg
gccaaaaaacaccccaaccgcatttcgaacggatttattctggagctggccgtcattctt
cttctcgaaagcctccttggtctgatggcagctcacatgggggcatctccttggctgatg
ggcgtagcttacgtcctcgcatacattcgtccggttctcttcgtaattctgggattcgcc
ctgttggtcaacggcatcatcggggtgcggcgcgaaggtttctcccttaccagtgcgctt
cccttcgcttggggtatcatgttgctcttttccggttactggttcctttgggggccgggg
cagggcatgtcgggctcggagttttacgtccgcgttatgaccttcgtgagcatgatggtg
aactacattcctatcgcgctctttggtgtctggttctcgaacgacatctgctataagtcc
ggcaaggctcctgaaaccgaatacatcattgtgctgggttgtagcattctcgacgacggc
acggtcacgccgctgctgcgggggcgcctggatgcggcgatcgcggcttgggagcaaggc
ggacgtcgcgcaacaatcatcacgtccggcggtcagggccatgacgaggtgatttccgaa
agccgtgccatggccaactacctgctttcgcagggcgtaccggaaagcagcattctcttg
gaagacaagtcctcaacgaccgaagagaatctgaagttctcgcatgccatcatggatgcc
cgcggtggagccgcacattgcaccattgccacgagctcctaccactgcctgcgcgccgcg
atgttcgcacgacgtcttggcatcaacgcaagctgcgtaggcggacacacggcggccttt
ttctatccggcggcgttcttccgcgaatatatcgccctgattatgcgtaaccgtcctgcc
gtcatcatcttcttcgggctcgttgtcgttcgctttgcgctcatgctgatggatatcgtt
ccggaaggcgtcttcttctaa

DBGET integrated database retrieval system