KEGG   Bifidobacterium dentium Bd1: BDP_0497Help
Entry
BDP_0497          CDS       T01143                                 

Definition
(GenBank) aminotransferase
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ADB09170
UniProt: D2Q8N4
LinkDB All DBs
Position
588336..589700
Genome map
AA seq 454 aa AA seqDB search
MATRSTIMDTNSFRPEMADALDPATRKLTEERDVLGPAYRLFYRNPVHLVKGVGSHLWDA
DGEEYLDVYNNVASVGHCHPRVVEALSKQASMLNTHTRYLHENILHYAEDILSTMPDELD
RIMFQCTGSEANDLAIRVAQTYTGGEGVIVTHEAYHGNSALTSKLSPALGTAQTLGLTMR
MIPTPDTYRLEIDGKAASECTAEEFGNWMAGEVRKAVADMERHGIKFAALLADSIFSSDG
VYPDPVGYLKPVIDTVHELGGVWIADEVQPGFTRTGDAFWGFGRQGIVPDLVTSGKPMAN
GLPTSLMAARHEVLEPFAGSIPYFNTFGGNPVCMAAAQAVLDVMRDEDTMGNAKKVGKVF
KDAVASLMPSHPCIGDVRGAGLYIGCEIVKPGTKEPDQKAALDILETLRDNHILTSVCGR
YGNILKLRPPLVFSESDVDWFMDGFTKTLETLKL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggccactcgatcaaccatcatggacaccaacagcttccgtccggagatggcggacgca
ctcgatccggcaacgcgcaagctcactgaggaacgcgacgtactcggaccggcttaccgc
ctgttctatcgcaatccggtgcatctggtgaaaggcgtcgggtctcatctgtgggatgcc
gacggcgaggaatacctcgacgtgtacaacaatgtggcatccgtgggccactgccatccg
cgcgtggtcgaggcgctgtccaagcaagcctcaatgctcaacacccacacccgctacctg
cacgagaacatcctgcattatgcggaagatatcctttccaccatgcccgacgagcttgac
cgcatcatgttccagtgcaccggctccgaagccaacgatctggccatacgagtggcccag
acctacaccggcggcgaaggcgtgatcgtgacgcacgaggcctaccatggcaactccgcc
ctgacttccaagctgtcaccggcactcggtaccgcacagaccttgggcctcacaatgcgc
atgattcccacccccgacacctaccgtctcgaaatcgacgggaaagcggcctccgaatgc
accgccgaggaattcggcaactggatggcgggtgaggtacgcaaggccgtggccgatatg
gaacgtcatggcatcaagttcgcggcactgctcgcggactccatcttctcgtccgacggt
gtgtatccggatccggtcggttacctgaagccggtcatcgataccgtgcacgagcttggc
ggcgtgtggattgccgacgaggtgcagcccggcttcacccgtaccggcgacgccttctgg
ggcttcgggcgccagggcatcgtgccggatctggtcacctccggcaagccgatggccaac
ggtctaccgacctcgctgatggcggcccggcacgaagtgctcgaaccattcgccgggtcc
atcccgtatttcaacaccttcggtggcaatccggtatgcatggccgcggcccaggccgtg
cttgacgtgatgcgtgacgaagacaccatgggcaatgccaagaaggtgggcaaggtattc
aaggatgccgtcgcctcgctcatgccgtctcatccgtgcatcggcgacgtgcgcggcgcc
ggtctgtacatcggctgcgaaatcgtcaagccgggtaccaaggagccagatcagaaagcg
gcgctcgatattcttgaaaccctacgtgacaatcacatcctcacatcggtgtgcggccga
tatggcaatattctcaagctgcgtccgccactggtgttcagcgaatccgacgtggactgg
ttcatggatggattcaccaagacactcgaaacattgaaactgtaa

DBGET integrated database retrieval system