KEGG   Bifidobacterium dentium Bd1: BDP_0501Help
Entry
BDP_0501          CDS       T01143                                 

Definition
(GenBank) Narrowly conserved hypothetical membrane spanning protein
Organism
bde  Bifidobacterium dentium Bd1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PspC
Motif
Other DBs
NCBI-ProteinID: ADB09174
UniProt: D2Q8N8
LinkDB All DBs
Position
593072..594946
Genome map
AA seq 624 aa AA seqDB search
MSNVHHDPRSNQWNAPQRPAGQPQPSSSNRFFAWIRKSQLKRGRDRWVGGVCDGLARRLG
WNVALVRALVILTSLFFGCGAAFYGMAWFLLPDETDDRILCEELIAGHWDWSCIGVFVCM
AIAICLPGAGWVAFAVAALILWLIVNRQTYVPAWQQQAQYGPVPHNSYVLGAQGAAGPMP
PQAPPFVATMDGPKPVSPWYQRGMPQQQGVPPYDSVYRQGPAGGTGDVPPQAHVSQQPMN
GPAAFATANVPPTFTAPAAPIEPQPRYGRRKPAGPFLVLMTFGLALLAVAGLYWYDTFDG
SKTSQNIIADKLQVTTLVAGGFCLLMGVIIIILGSMGRRAGGLHPLTWLAATMAVIMVIC
TGTYSICWYRFKQNDTYQTVALAGTKVMGSSAAQMKRYGNGIAVVGNDYDSDILHIDLSQ
YGKNNGSHKVRLNDGTMGDSTCPTGTINMTVSSAQVVVTIPDGCWWTLGGYEDEDYDEYS
VLDHIGGPSEINMMDAGGAIDGTLSFGSDYRSDAMAGQRAFDTTDRDTGCRFMHPDDSTD
SDDSDDSADATSGQRFDSPFKDADTDKALNKVYAQHWYWPCLAGESKAPKPDLTINPHVT
IGGSVTVQYASQNTLPTFNGKETK
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgtacaccatgatccgcgaagcaaccagtggaacgcgccgcagcggcctgca
ggccagccgcaaccctcctcgtccaaccggttcttcgcatggattcgaaaaagtcagctg
aagcgagggcgcgaccgttgggtcggcggtgtctgcgatgggcttgcccgtcgtcttggt
tggaatgtggcgttggtgcgtgcgctggtgattctcacctcgctgttcttcggatgcggc
gccgccttctacggcatggcctggttcctgctgccggacgagaccgacgaccgtatcctg
tgtgaggaactgatcgcaggccactgggattggagctgtatcggcgtgttcgtgtgcatg
gcgatcgccatctgcctgcccggggcgggctgggtggcctttgcggtggcggcactcata
ttgtggctgatagtaaatcggcagacctatgtgccggcttggcagcagcaggcgcagtat
ggtccggtaccgcacaattcttacgttctcggcgcgcagggtgccgccgggccgatgcca
ccgcaggccccaccgttcgtggcgacaatggacggaccgaagccggtttcgccgtggtat
caacgtggcatgccgcaacagcagggagtcccgccgtacgattccgtctatcggcagggg
cctgcgggcggtacgggtgacgtcccgccgcaagcccatgtgtcgcagcagccgatgaac
gggccggccgcgttcgccacggccaacgtgccgccgactttcaccgcgccagccgccccg
atcgaaccgcagccgcgatacgggcgcaggaagccggccgggcccttcctggtgcttatg
accttcggtctcgcactgctcgcggtcgccggactgtactggtatgacacgttcgacggt
tccaagaccagtcagaacatcattgcggacaagctgcaggtgacgacgctggttgccggt
ggattctgcctgctgatgggcgtgatcatcatcatccttggaagcatgggccgacgtgcc
ggcggcctgcatccgctgacgtggctcgccgcgaccatggccgtcatcatggtgatatgc
accggaacctattccatctgctggtacaggttcaagcagaacgacacctaccagaccgtc
gcgcttgcaggtaccaaggtgatgggctcgtccgccgcgcagatgaagcgatacggcaac
ggcatcgccgtcgtcggcaacgactatgacagcgacatactgcacatcgacctgagccag
tatggcaagaacaatggctcgcacaaggtcaggctcaacgacggcaccatgggcgacagc
acctgcccgacgggaacgatcaatatgaccgtatcgagtgcccaagtggtggtgaccatt
cccgatggatgctggtggaccctcggcgggtacgaggacgaggattacgacgagtactcc
gttctggatcacatcggaggaccgtccgaaatcaacatgatggatgccggcggcgccatc
gacggtacgctctcgttcggttcggactatcggtccgacgccatggcggggcagcgggcc
tttgatacgacggaccgcgacacaggttgccggttcatgcatccggacgattccacggat
tcggacgattcggatgattccgccgatgccacgagcggtcaacggttcgactccccattc
aaggacgccgataccgacaaagccctgaacaaggtctacgcccagcattggtactggcca
tgcctggccggggaaagcaaagccccgaaaccggatctgacaatcaacccgcatgtgacc
atcggcggcagcgtcaccgtacagtacgcttcgcagaacacgctgccgaccttcaatgga
aaagagacgaaatga

DBGET integrated database retrieval system