KEGG   Bifidobacterium dentium Bd1: BDP_0671Help
Entry
BDP_0671          CDS       T01143                                 

Definition
(GenBank) Cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde00270  Cysteine and methionine metabolism
bde00450  Selenocompound metabolism
bde00920  Sulfur metabolism
bde01100  Metabolic pathways
bde01110  Biosynthesis of secondary metabolites
bde01130  Biosynthesis of antibiotics
bde01230  Biosynthesis of amino acids
Module
bde_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:bde00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BDP_0671
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BDP_0671
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BDP_0671
Enzymes [BR:bde01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     BDP_0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADB09334
UniProt: D2Q948
LinkDB All DBs
Position
773698..774477
Genome map
AA seq 259 aa AA seqDB search
MTISTNTAALNATALATRAIHAGQEPDPTTGAVVTPIYMTSTFKQDGVGGLRGGYDYSRS
VNPTRNSFDEQLAAVEGARYALSFSSGLAAIDVLLRSTIRPGDNILLGNDVYGGTYRLLS
KVFVPWGIGLDVVDITDTAAVSAALGKKQYKYIWVETPSNPLLNITDIAATSAVAHAHGT
KVVVDNVRLAGIAASIGRRCRRGRLLHHQVHRRPLRRGRRRRGSQRQGDPRRGGLPAERS
RCRAVPVRLLARHPRPEDP
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaccatctcgaccaacaccgcagccctgaacgccaccgcactcgccacccgtgccatc
cacgccggacaggaacccgacccgaccaccggagccgtggtcacgccgatctacatgacc
tccacgttcaagcaggacggcgtcggcgggctacgcggaggctacgattacagccgttcc
gtcaacccgacccgcaactccttcgacgagcagctcgccgcagtggaaggtgccaggtat
gcgctgagcttctcctcgggcctggccgccatcgatgtactgctgcgttccaccatcagg
ccgggcgacaacattctgctcggcaacgacgtgtacggcggcacctatcgattgctgtcc
aaggtgttcgtgccgtggggcatcggcctcgatgtggtcgacatcaccgacactgcggcc
gtctccgccgcgctgggcaagaagcagtacaagtacatctgggtcgaaaccccctccaac
ccgttgctgaacatcaccgacatcgccgccacctccgcagtggcgcatgcgcacggcacc
aaggtggtcgtggacaacgttcgcctcgccggtattgcagcatccattggccgacggtgc
cgacgtggtcgtctactccaccaccaagtacatcggcggccactccgacgtggtcggcgg
cgccgtggttctcaacgacaaggagacccgagacgaggtggccttcctgcagaacgcagc
cggtgccgtgccgtccccgttcgactcctggctcgacatccgaggcctgaagacccttga

DBGET integrated database retrieval system