KEGG   Bifidobacterium dentium Bd1: BDP_0672Help
Entry
BDP_0672          CDS       T01143                                 

Gene name
metB
Definition
(GenBank) metB Cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde00270  Cysteine and methionine metabolism
bde00450  Selenocompound metabolism
bde00920  Sulfur metabolism
bde01100  Metabolic pathways
bde01110  Biosynthesis of secondary metabolites
bde01130  Biosynthesis of antibiotics
bde01230  Biosynthesis of amino acids
Module
bde_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:bde00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BDP_0672 (metB)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BDP_0672 (metB)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BDP_0672 (metB)
Enzymes [BR:bde01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     BDP_0672 (metB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ADB09335
UniProt: D2Q949
LinkDB All DBs
Position
774302..774877
Genome map
AA seq 191 aa AA seqDB search
MVVYSTTKYIGGHSDVVGGAVVLNDKETRDEVAFLQNAAGAVPSPFDSWLDIRGLKTLDL
RVKQHSRNALKVAQWLETRPEVERVWYPGLESHPGHEIAARQMHGGFGGMISVQIAAGFE
AAKKFAGATEVFTLAESLGGVESLIEHPGAMTHASVAGTTLEVPANLVRLSVGLEDADDL
IADLEQAFRQI
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgtctactccaccaccaagtacatcggcggccactccgacgtggtcggcggcgcc
gtggttctcaacgacaaggagacccgagacgaggtggccttcctgcagaacgcagccggt
gccgtgccgtccccgttcgactcctggctcgacatccgaggcctgaagacccttgacttg
cgtgtcaaacagcacagccgcaatgcgctcaaggtggcgcagtggctcgaaacccgtccg
gaagtggaacgtgtatggtatccgggtcttgaatcccatccgggacacgagatcgccgca
cgtcagatgcacggcggcttcggcggcatgatctccgtgcagatcgcggccggtttcgaa
gcggccaagaagttcgctggcgccaccgaagtgttcacgttggccgaatccctgggcggt
gtggaatcgctgatcgaacatccgggtgccatgacccacgcctccgtggccggtaccacc
cttgaagtgcctgccaatctggttcgcctgtccgtcgggctcgaagacgccgacgacctg
atcgccgacctcgagcaggcgttccgccaaatctga

DBGET integrated database retrieval system