KEGG   Bifidobacterium dentium Bd1: BDP_1414Help
Entry
BDP_1414          CDS       T01143                                 

Gene name
pknA2
Definition
(GenBank) pknA2 Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bde  Bifidobacterium dentium Bd1
Brite
KEGG Orthology (KO) [BR:bde00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bde01001]
    BDP_1414 (pknA2)
Enzymes [BR:bde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BDP_1414 (pknA2)
Protein kinases [BR:bde01001]
 Serine/threonine kinases: Other
  Bacterial family
   BDP_1414 (pknA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kinase-like Kdo Haspin_kinase RIO1
Motif
Other DBs
NCBI-ProteinID: ADB10022
UniProt: D2QB36
LinkDB All DBs
Position
1588516..1590585
Genome map
AA seq 689 aa AA seqDB search
MYQAMDERLERTVAIKIMHTQLAQGPHRDQFVQRFHREAKSAAAIANPHIVQVYDTGEFN
GLDYLVMEYVHGVNLRYEMNQQGTFSVRETLRVVGETLDGLASAHRAGVVHRDIKPENIL
LNDRGHVQITDFGLAKAASQATLSSTGMLLGTAAYLAPEMIENNQATPQGDLYSVGIMAW
EMLTGEVPFTADNPVTLVFKHVHEDVPSVSTKCPGINADVAAFIAHIAARSVDARPADAS
VALQELQRLQSKLSIEDWQYRLPPSTDVTGPDDATAPMISPIPEPPAPPTKTTVMSPDAT
TQLPPSLAFLQENAPRRTPDATQVIGTGTGNGGAAPSFTGQRTPSENGEVKEQRNKSHGP
LIAAAVAALLVIGGIGGGWAWWYYRGPGSYWTMPTPTGIQCATGQTCRITNTSWSEYERL
LKVANIPYSTSKAYDDTIAKGNIISTDPANVLDHVSKRNGQKVKIVISQGVKQATVPADI
LDATSANGKDPINALKKAGFDDIEQTAASDDDYSMDVPQGALLSISVDPGATLPHNTKIS
VTLSQGPKPVTMPDIVGKTQDEAQQALDELKLTANWTEQFDDKIPQGQVISASAKSGDAL
HWGDEVDVVVSKGPETVTLPNYVGQKASEAKSALEKLGFSVKISSQLTLDSSQDKKVASQ
DPVGGTEVRLRQEDGTPTTVTLKMYSSLF
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
gtgtatcaggccatggacgagcgtctggagcgcaccgtcgccatcaagatcatgcacacc
caattggcgcagggcccccatcgcgatcagttcgtacaacggttccaccgcgaggccaag
tcggcggccgccatcgccaaccctcatatcgtacaggtgtatgataccggcgaattcaat
ggtctggactatctcgtcatggagtacgtgcatggcgtgaacttacggtacgaaatgaac
cagcagggcacgttcagcgtacgcgagacactacgcgtcgtgggcgaaacactggatggc
cttgcctcggcccaccgtgccggcgtggtgcatcgtgacatcaagccggagaatatcctg
ctcaacgatcgcgggcatgtgcagatcaccgatttcggtctggcgaaggccgcctcgcag
gccacgttgtcttcgacggggatgttgcttggtacggcggcctatctggcaccggaaatg
attgaaaacaatcaggccacccctcaaggcgatctgtattccgtaggcatcatggcatgg
gaaatgttgaccggagaggtgccgttcactgcggataatccggtgacgctcgtattcaag
catgtgcatgaggatgtaccgtccgtgtccacaaagtgccccggcatcaatgcggatgtg
gccgcgttcatagcgcatatcgccgcccgatccgtcgatgcgcgccctgccgacgcctcc
gtggcgttgcaagagctgcaacgactgcagtccaaactgtcgattgaggattggcaatat
cgtttgcccccttccaccgacgtgactggccccgatgacgccactgcgcccatgatttcg
ccgattcccgaaccaccagcacctccgacgaagaccaccgtcatgtcgccggacgccacc
acgcaactgccaccatcactggcgttcctgcaggagaacgctccacggcggacacccgac
gccacgcaggtaatcggaacaggtacgggcaacggcggtgccgcgccgtctttcaccggg
cagcggacaccaagcgagaatggcgaggtcaaggagcaacgcaacaaatcgcatggaccg
ctcatcgcagccgcagtcgcggcgctgctggtaatcggcggaatcggcggcggttgggca
tggtggtattaccgtggtcccggtagctactggaccatgccgacccccacgggaatccaa
tgcgcaaccggacagacttgccgcatcaccaatacttcatggagcgaatacgaacggctg
ctgaaggtcgccaacattccatactcgaccagcaaagcctatgacgacaccatcgccaaa
ggcaacatcatctccaccgatccggcgaacgtgctcgaccatgtcagcaagaggaacggt
cagaaggtgaaaatcgtgatttcccaaggagtgaagcaggcgaccgtgcccgccgatatt
ctcgatgcgaccagtgcgaacggcaaagatccgatcaatgcgctaaaaaaggccggcttc
gatgacatcgaacaaaccgccgcctccgacgacgattattcgatggacgtgccgcaaggc
gcattgctgagcatcagcgtcgatccgggcgcgacgttgcctcataacacgaagatttcg
gttacgctctcacagggtccgaagcccgtgaccatgccggatatcgtcggcaagacgcag
gatgaggcgcaacaggcactggatgagctcaagctcactgcgaactggactgaacagttc
gatgacaagattccccaagggcaagtgatttcagcttccgccaagtccggtgacgccctg
cattggggagatgaggtggatgtggtcgtttcgaagggtccggaaacggtgaccctgccg
aattatgtgggccaaaaggcatccgaagcaaaaagcgcgctggaaaagctgggcttcagc
gtgaaaatcagttcgcagttgaccttggattccagccaggacaagaaagtggcctcacag
gatccggtcggcggcactgaggttcgtttgcgccaggaggacggcacgccgaccaccgtc
accctgaaaatgtactcatccctgttctaa

DBGET integrated database retrieval system