KEGG   Bifidobacterium dentium Bd1: BDP_2205Help
Entry
BDP_2205          CDS       T01143                                 

Definition
(GenBank) Permease protein of ABC transporter system for sugars
  KO
K10118  raffinose/stachyose/melibiose transport system permease protein
Organism
bde  Bifidobacterium dentium Bd1
Pathway
bde02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bde00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BDP_2205
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bde02000]
    BDP_2205
Transporters [BR:bde02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Raffinose/stachyose/melibiose transporter
    BDP_2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 HKR_ArcB_TM
Motif
Other DBs
NCBI-ProteinID: ADB10761
UniProt: D2Q7J9
LinkDB All DBs
Position
complement(2533840..2534694)
Genome map
AA seq 284 aa AA seqDB search
MISMTGKAIRKWWALFALPTFAAFIIGFVIPFIMGIYLSFCKFTTVTDAEFVGLKNYQKA
FADKEFLHALGFSVALTIVTTIVINVAAFAIAYMLTKAIKGSNIFRSVFFMPNLIGGIIL
GYIWMLLLNGILAHWGRALTYSATYGFWGLVILVCWQQIGYMMIIYIAGMQSLPTDVLEA
AAVDGATGSQTMFRIIIPLMMPSITVCSFLCVTNGFKLYDQNLALTNGAPSNMSEGLAMN
ITRTFYGRMGWEGVGQAKAVLFFVLVAVVAIIQNKLTTSREVEA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcatgaccggcaaggcgatacggaaatggtgggcgctattcgcgttacctacg
ttcgctgcgttcatcatcgggttcgtgatcccgttcatcatgggtatatatttgagcttc
tgcaaattcaccactgttaccgacgcggagttcgtggggctcaaaaactatcaaaaggca
ttcgcggataaggaatttttgcatgcgctcggcttttccgtggcgctgaccatcgtgacg
accatcgtgatcaacgtggccgcattcgccatcgcgtatatgctcaccaaagccatcaag
ggttcaaacatctttcgttccgtgttcttcatgccgaacctcatcggcggcatcatcctg
ggctatatctggatgctgctgctcaacggcatcctcgcccattggggccgcgcactgaca
tacagcgccacatacggattttggggcttggtcatcctggtatgttggcagcagatcggc
tacatgatgatcatctatatcgcaggcatgcagtccctgccgactgacgtgcttgaagcc
gccgccgttgacggggcgaccggatcgcagaccatgttcaggatcatcattccgctgatg
atgccatcgatcaccgtctgctcgttcctgtgcgtaaccaacgggttcaagctttatgat
cagaaccttgcgttgaccaacggcgctccgtcgaacatgtccgagggcttggccatgaac
atcacacgcaccttctacgggcgcatgggttgggaaggcgtcggccaggccaaggccgtg
ctgttcttcgtcttggtggcggtggtcgcaatcattcagaacaaactcacgacttccagg
gaggtggaggcatga

DBGET integrated database retrieval system