KEGG   Burkholderia diffusa: WI26_00865Help
Entry
WI26_00865        CDS       T04698                                 

Definition
(GenBank) chemotaxis protein CheA
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
bdf  Burkholderia diffusa
Pathway
bdf02020  Two-component system
bdf02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WI26_00865
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    WI26_00865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bdf01001]
    WI26_00865
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bdf02022]
    WI26_00865
   02035 Bacterial motility proteins [BR:bdf02035]
    WI26_00865
Enzymes [BR:bdf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     WI26_00865
Protein kinases [BR:bdf01001]
 Histidine kinases
  CheA family [OT]
   WI26_00865
Two-component system [BR:bdf02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   WI26_00865
Bacterial motility proteins [BR:bdf02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    WI26_00865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheY-binding CheW Hpt H-kinase_dim HATPase_c Ndc1_Nup
Motif
Other DBs
NCBI-ProteinID: AOI56257
UniProt: A0A1B4BNK1
LinkDB All DBs
Position
1:203514..205751
Genome map
AA seq 745 aa AA seqDB search
MTLDITQFYQTFFDEADELLAQMEQLLLNLDVGSPDPEDLAAIFRAAHSIKGGAATFGFS
ALTETTHILESLLDRARNHELTLTKEMVDAFLETKDVLSDQLVDYRASAEPDAAAAATIC
AKLERLKAESGGGVAAAADAAQAVPAVTAATAEVAAPAPAPAAADRAPDHVVEQAVAAAH
PADDAGAGGPHLKITLVGVDAKDQALLTEELGNLGRIVGREEAGADLTLWLESDVPSDDI
VAVCCFVIDDSQIRIARGTAPAAPAAPAAAPAALEPAAAPEPAARVEVFAQAAGAAPAAA
ASQALAQPAPQAAPQPHAEPAAPAAQAAAHHDDKRPRPAAAASGAEGSSIRVGVEKVDQL
INLVGELVITQAMLAETASAFDPALHDRLFNGMAQLERNARDLQEAVMSIRMMPMDYVFS
RFPRLVRDLAGKLGKQVELVTFGQATELDKSLIERIIDPLTHLVRNSLDHGIETVDKRIA
AGKDAVGQLVLSAAHHGGNIVIEVSDDGGGLNRERILAKAAKQGMQIPDTISDDEVWQLI
FAPGFSTAETVTDVSGRGVGMDVVKRNIQSMGGHVEISSQAGRGTTTRIVLPLTLAILDG
MSVKVGTEIFILPLNFVMESLQPSNDDIYTVGNGERVVRVRGEYLPLVALHEVFSVDDAR
TDPTQGIVTIMETEGRRFAMLIDELVGQQQVVVKNLETNYRKVHGISAATILGDGSVALI
VDVAALNRETRATHGARAGAELAIF
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgactctcgacatcacgcagttctaccagacctttttcgacgaagcggacgagctgctc
gcgcagatggagcagctgctgctgaacctcgacgtcggctcgcccgaccccgaggacctg
gccgcgatcttccgcgccgcgcattcgatcaagggcggcgcggcgaccttcggcttttcc
gcgctgaccgagacgacccacatcctggagtcgctgctcgaccgcgcacgcaaccatgag
ctgacgctgaccaaggaaatggtcgacgcgttcctcgagaccaaggacgtgctgtccgac
cagctcgtcgactatcgcgcgagcgcggaaccggacgcggcggccgccgcgacgatttgc
gcgaagctcgaacgcctgaaggccgagagcggcggcggtgtggctgcggccgcggatgcc
gcgcaggccgtgccggctgtaactgccgcaacggccgaggtggccgctccggcgccggcg
ccggccgctgccgatcgcgcgcccgatcacgtggtcgaacaggccgtcgcggccgcgcat
ccggcggacgacgccggcgcgggcggcccgcacctgaagatcacgctcgtcggtgtcgac
gcgaaggaccaggcgctgctcaccgaggaactgggcaatctcggccggatcgtcggccgt
gaggaagcgggcgcggacctgacgctgtggctcgaatcggacgtgccgtccgacgacatc
gtcgccgtgtgctgcttcgtgatcgacgacagccagatccgcatcgcgcgcggcaccgcg
ccggccgcaccggcggcgcccgccgccgcgccggccgcgctcgaaccggccgccgcgccg
gagccggccgcacgcgtcgaggtattcgcgcaagccgccggtgccgcaccggccgccgcc
gcgtcgcaagcgctggcgcaaccggcgccgcaagcggccccgcaaccgcacgccgaaccc
gccgcgccggctgcccaggctgccgcgcaccacgacgacaagcgcccgcgcccggccgcc
gccgcgtcgggcgccgaaggcagctcgattcgcgtcggcgtcgagaaggtcgaccagctg
atcaacctggtcggcgaactcgtgatcacgcaggcgatgctcgcggaaacggcgagcgcg
ttcgatccggcgctgcacgatcgcctgttcaacggaatggcgcagctcgagcgcaacgcg
cgcgacctgcaggaagcggtgatgtcgatccgcatgatgccgatggactacgtgttcagc
cgcttcccgcgcctcgtgcgcgacctggccggcaagctcggcaagcaggtggagctcgtc
acgttcggccaggcgaccgagctcgacaagagcctgatcgagcggatcatcgacccgctc
acgcacctcgtgcgcaacagcctcgaccacgggatcgagaccgtcgacaagcgtatcgcc
gcgggcaaggacgcggtcggccagctcgtgctgtcggccgcgcatcacggcggcaacatc
gtgatcgaggtcagcgacgacggtggcggcctgaaccgcgagcggattctggcgaaggcc
gccaagcagggcatgcagatccccgacaccatcagcgacgacgaagtctggcagctgatc
ttcgcgccgggcttctcgacggccgagacggtgaccgacgtgtcgggccgcggcgtcggg
atggacgtcgtgaagcgcaacatccagtcgatgggcggccacgtcgagatctcgtcgcag
gccggccgcggcacgaccacgcggatcgtgctgccgcttacgctcgcgatcctcgacggg
atgtcggtgaaggtcggcacggagatcttcatcctgccgctgaacttcgtgatggagtcg
ctgcagccgtcgaacgacgacatctacacggtcggcaacggcgagcgcgtggtgcgcgtg
cgcggcgaatacctgccgctggtcgcgttgcacgaagtgttctcggtcgatgacgcgcgc
accgacccgacccagggcatcgtcacgatcatggaaaccgagggacgccgcttcgcgatg
ctgatcgacgagctcgtcggccagcagcaggtggtcgtgaagaacctcgaaacgaactac
cgcaaggtgcacggcatctcggcggcgaccatcctcggcgacggcagcgtcgcgctgatc
gtcgacgtcgcggcgctgaaccgtgaaacccgtgcgacgcacggcgcccgagcgggcgcc
gagctcgcaatcttctga

DBGET integrated database retrieval system