KEGG   Burkholderia diffusa: WI26_02350Help
Entry
WI26_02350        CDS       T04698                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bdf  Burkholderia diffusa
Pathway
bdf00473  D-Alanine metabolism
bdf00550  Peptidoglycan biosynthesis
bdf01100  Metabolic pathways
bdf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    WI26_02350
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    WI26_02350
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    WI26_02350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bdf01011]
    WI26_02350
Enzymes [BR:bdf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     WI26_02350
Peptidoglycan biosynthesis and degradation proteins [BR:bdf01011]
 Precursor biosynthesis
  Amino acid ligase
   WI26_02350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_ST ATP-grasp ATP-grasp_4 TTL ATPgrasp_YheCD PPR
Motif
Other DBs
NCBI-ProteinID: AOI56520
UniProt: A0A1B4BPD3
LinkDB All DBs
Position
1:516562..517503
Genome map
AA seq 313 aa AA seqDB search
MSGIDPKRFGKVAVLFGGESAEREVSLTSGRLVLQGLRDAGVDAHPFDPAERPLSALKDE
GFVRAFNALHGGYGENGQIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPP
FETVMRGDDYATRAADIVAKLGLPLFVKPASEGSSVAVLKVKTADALPAALSEAATHDKI
VIVEKSIEGGGEYTACIAGDLDLPLIKIVPAGEFYDYHAKYVADDTQYLIPCGLPADKEA
ELKRIARRAFDVLGCTDWGRADFMLDAAGNAYFLEVNTAPGMTDHSLPPKAARSIGISYS
ELVVKVLSLTLND
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcgatccgaaacgtttcggcaaggtggcggtgttgttcggcggcgaatcg
gccgagcgcgaggtgtcgctcacctcgggccgtctcgtgctgcagggcttgcgtgacgcg
ggcgtcgacgcgcatccgttcgacccggccgagcggccgctgtcggcgctgaaggacgaa
ggcttcgtgcgcgcgttcaacgcgctgcacggcggctacggcgagaacggccagatccag
ggcgcgctcgatttctacgggattcgctacacgggcagcggcgtgctcggctcggcgctt
ggtctcgacaagttccgcacgaagctggtgtggcagcagacgggcgtgccgacgccgccg
ttcgagacggtgatgcgtggcgacgactacgcgacgcgcgcggcggacatcgtcgcgaag
ctcggcctgccgctgttcgtgaagccggcgagcgaaggctcgagcgtcgcggtgctgaag
gtgaagacggccgacgcgttgcccgccgcactgtcggaagccgcgacgcacgacaagatc
gtgatcgtcgagaagagcatcgaaggcggcggcgaatacaccgcgtgcatcgccggcgat
ctggacctgccgctgatcaagatcgtgccggccggcgagttctacgactaccacgcgaag
tatgtcgccgacgacacgcagtacctgattccgtgcgggctgccggccgacaaggaagcg
gaactgaagcgcatcgcgcgccgtgcgttcgacgtgctcggctgcaccgactgggggcgc
gcggatttcatgctcgacgccgccggcaacgcgtatttcctggaagtgaacacggccccc
gggatgaccgaccactcgctgccgccgaaggctgcgcgctcgatcggcatcagctattcg
gagctggtcgtgaaggtgctgtcgcttacgctcaacgactga

DBGET integrated database retrieval system