KEGG   Burkholderia diffusa: WI26_03180
Entry
WI26_03180        CDS       T04698                                 

Definition
(GenBank) acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bdf  Burkholderia diffusa
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    WI26_03180
Enzymes [BR:bdf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     WI26_03180
SSDB
Motif
Pfam: CN_hydrolase
Other DBs
NCBI-ProteinID: AOI56674
UniProt: A0A1B4BPS4
LinkDB
Position
1:complement(699457..700284)
AA seq 275 aa
MTDHTRSATPFRVAALQMVSTPDVARNLAEAGRLIAEAAGDGAQLVLLPEYFCFMGHRDT
DKLALAEPYRDGPIQRFLSEAAHRHGIWVIGGTLPLKAPEPDRVLNTTLVFDPTGHEAAR
YDKIHLFNFEKGDESFDEARTIRAGDTVVAFDAPFGRVGLSVCYDLRFPELYRRMGDCAL
IVVPSAFTYTTGRAHWDMLLRARAVENQCYVLAAAQGGKHENGRRTWGHSMLIDPWGEIV
AVRDEGASVVTGALDPQRIADVRQSLPAWRHRVLA
NT seq 828 nt   +upstreamnt  +downstreamnt
atgaccgatcacacccgttccgccacaccctttcgggtcgccgcgctgcagatggtgagc
acgccggacgtcgcacgcaatctcgccgaagccggccgcctgatcgcggaagcggccggc
gacggcgcgcagctcgtgctgctgcccgagtatttctgcttcatgggccatcgcgacacc
gacaagctcgcgctcgccgaaccctaccgcgacggcccgatccagcgcttcctctcggag
gccgcgcaccgtcacggcatctgggtgatcggcggcacgctgccgctgaaggcgcccgaa
cccgatcgcgtgctgaacacgacgctcgtattcgacccgaccggccacgaagcagcgcgc
tacgacaagatccacctattcaacttcgagaaaggcgacgaatcgttcgacgaggcgcgc
acgatccgcgcgggcgacaccgtcgtcgcgttcgacgcgccgttcgggcgggtgggcctg
tcggtctgttacgatctgcgctttccggagctgtatcgcaggatgggcgactgcgcgctg
atcgtcgtgccatcggcgtttacgtatacgacgggccgcgcgcactgggacatgctgctg
cgcgcgcgggccgtcgagaaccagtgttatgtgctcgcggccgcgcaaggcggcaagcac
gagaacggccggcgcacctggggccacagcatgctgatcgacccgtggggcgagatcgtc
gcggtccgcgacgaaggcgcgagcgtcgtgaccggcgcgctcgatccgcagcgcatcgcc
gatgtgcgccagagcctgcccgcgtggcggcatcgcgtgctggcctga

DBGET integrated database retrieval system