KEGG   Burkholderia diffusa: WI26_08005Help
Entry
WI26_08005        CDS       T04698                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bdf  Burkholderia diffusa
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    WI26_08005
Enzymes [BR:bdf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     WI26_08005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 Glutaredoxin2_C GST_C_6
Motif
Other DBs
NCBI-ProteinID: AOI57550
UniProt: A0A1B4BSA9
LinkDB All DBs
Position
1:complement(1742449..1743153)
Genome map
AA seq 234 aa AA seqDB search
MPDLSAFPITKKWPAQHPDRLQLYSLPTPNGVKVSIMLEETGLPYEPHLVRFDTNDQLSP
EFLSLNPNNKIPAIIDPNGPDGRPLPLFESGAILIYLADKTGQLIPKDPAGRYETIQWVM
FQMGGIGPMFGQVGFFHKFAGRDYEDKRPRDRYVAESKRLLAVLDAHLANRKWMMGDTYT
IADIAIFPWVRNLVGFYEAGDLVGFGEFKHVARALDAFVARPAVARGLNIPARD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatctgtccgccttcccgatcacgaagaaatggcctgcccagcatcccgaccgt
ctgcagctgtactcgctgccgacgccgaacggcgtcaaggtgtcgatcatgctcgaggaa
accggcctgccgtacgagccgcacctcgtgcgcttcgacaccaacgaccagctgtcgccc
gaattcctgtcgctgaatccgaacaacaagatcccggcgatcatcgatccgaacggcccc
gacggccggccgctgccgctgttcgaatccggcgcgatcctgatctatctcgcggacaag
acgggccaactgatcccgaaggatcccgccggccgctacgagacgatccagtgggtgatg
ttccagatgggcggaatcgggccgatgttcggccaggtcggcttcttccacaagttcgcg
ggccgcgattacgaggacaagcgtccgcgcgatcgctacgtcgcggaatcgaagcgcctg
ctcgccgtgctcgacgcgcatctcgcgaatcgcaagtggatgatgggcgacacgtacacg
atcgccgacatcgcgatcttcccgtgggtgcgcaacctggtcggcttctatgaagcgggc
gacctggtcggcttcggcgaattcaagcatgtcgcgcgggcgctcgacgcgttcgtcgcg
cgtccggccgtcgcgcgcgggctcaacatcccggcacgcgactga

DBGET integrated database retrieval system