KEGG   Burkholderia diffusa: WI26_09675Help
Entry
WI26_09675        CDS       T04698                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bdf  Burkholderia diffusa
Pathway
bdf00473  D-Alanine metabolism
bdf01100  Metabolic pathways
bdf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    WI26_09675
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    WI26_09675
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bdf01011]
    WI26_09675
Enzymes [BR:bdf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     WI26_09675
Peptidoglycan biosynthesis and degradation proteins [BR:bdf01011]
 Precursor biosynthesis
  Racemase
   WI26_09675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AOI57860
UniProt: A0A1B4BT73
LinkDB All DBs
Position
1:complement(2104739..2105809)
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLSVVRRFAGPSKVWAVVKANAYGHGLARVFPGLRGTDGFGLLD
LDEAVKLRELGWAGPILLLEGFFRSTDIDVIDRYSLTTTVHNDEQMRMLETARLSKPVNV
QLKMNSGMNRLGYVPEKYRAAWERARACPGIGQITLMTHFSDADNERGVAEQLATFERGA
ENIAGARSLANSAAVLWHPDTHFDWVRPGIVLYGASPSGLSADIADTGLKPAMTLASELI
AVQTIAKGQAIGYGSTFSAQAPMRIGVVACGYADGYPRVAPEGTPVIVDGIRTRIVGRVS
MDMITVDLTPCPQAGVGARVELWGNALPIDDVARHCWTIGYELMCAVAGRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatctccgccaccatccataccgccgctctcgcgaacaatctctccgtc
gtccgccgatttgccggcccgtccaaggtctgggcggtcgtcaaggccaacgcatacggc
cacggtctcgcgcgcgtgtttcccggcctgcgcggcaccgacggcttcggcctgctcgac
ctcgacgaggccgtgaagctgcgcgagctcggctgggccggcccgatcctgctgctcgaa
gggttcttccgctcgaccgacatcgacgtgatcgaccgctacagcctgacgaccaccgtc
cacaacgacgagcagatgcggatgctggagacggcgcggttgtccaagcccgtcaacgtg
cagctcaagatgaacagcgggatgaaccggctcggctacgtgccggagaaataccgcgcc
gcgtgggagcgcgcccgtgcgtgccccggcatcggccagatcacgttgatgacccatttt
tcggatgccgacaacgagcgcggcgtggccgagcagctggcgacgttcgagcgcggtgcg
gaaaacatcgccggtgcgcgcagtctcgcgaattcggcggccgtcctgtggcatccggat
acgcatttcgactgggtgcggcccgggatcgtgctgtacggcgcatcgccgtcggggctg
tcggccgacatcgccgacaccggcctgaagcccgcgatgacgctcgcgtccgagctgatc
gccgtgcagacgatcgcgaaggggcaggcgatcggctacggctcgacgttctccgcgcaa
gcgccgatgcgcattggcgtcgtcgcgtgcggctatgcggacggctatccgcgcgtcgcg
cccgaaggcacgccggtgatcgtcgacggaatccgcacgcggatcgtcggccgcgtgtcg
atggacatgattaccgtcgacctgacgccgtgcccgcaggccggcgtcggcgcgcgggtc
gagctgtggggcaacgcgctgccgatcgacgacgtcgcgcgccattgctggacgatcggc
tatgaactgatgtgcgcggttgccggccgcgtaccggtgcgcgcggaataa

DBGET integrated database retrieval system