KEGG   Burkholderia diffusa: WI26_13960Help
Entry
WI26_13960        CDS       T04698                                 

Definition
(GenBank) peptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
bdf  Burkholderia diffusa
Pathway
bdf00550  Peptidoglycan biosynthesis
bdf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    WI26_13960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bdf01002]
    WI26_13960
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bdf01011]
    WI26_13960
Enzymes [BR:bdf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     WI26_13960
Peptidases and inhibitors [BR:bdf01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   WI26_13960
Peptidoglycan biosynthesis and degradation proteins [BR:bdf01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   WI26_13960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AOI58632
UniProt: A0A1B4BVD9
LinkDB All DBs
Position
1:complement(3031225..3032541)
Genome map
AA seq 438 aa AA seqDB search
MRLSSQGLKSLASSIAFGTAARNVALGVMLPVALASTIVVAEAKPAAKTKAAHAAPAAAA
EQFTGAPATFMPGAVPPPGVNARSWVLVDATSNTVLASGNADERVEPASLTKLMTAYLVF
EALDKKKISMEQIVTPSEAVRRVGRDESRMFIEANKPVSVHDLVYGMIIQSGNDAAIALA
ELVGGSEGQFVTMMNDEAARLGMKGTHFADVNGMPDPNHYTTAGDLAKLSAHLIRDFPQY
YSIFSEKEFKYNNIRQGNRNRLLWLDPTVDGLKTGHTQAAGYCLIASAKRAIPGVDSQRR
LVSVMMGEQKEGERTQDSMKMLNYGYSAFDAVRLFKGGQAMSTPRIYKGKENTVQVGVKG
DQWVTVPRGLGDKVKPEVEVNAPLIAPLAEGQQVGTVKIVADGKTLSEFPVVALQAVPEA
GIFGRIWDSILLMFSKKK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgtcttcccaaggcctcaagtccctcgcttcttccatcgccttcggcaccgcc
gcgcgcaacgtcgcgctgggcgtgatgctgcccgtcgcactcgcgtcgacgatcgtcgtc
gccgaggcgaagccggccgccaagaccaaggccgcgcatgccgcgccggccgccgccgcc
gagcagttcaccggcgcgcccgcgaccttcatgccgggcgcggtgccgccgcccggcgtg
aacgcgcgctcgtgggtgctcgtcgatgcgacgagcaacaccgtgctcgcatcgggcaac
gccgacgaacgcgtcgagcccgcgtcgctgacgaagctgatgacggcctacttggtgttc
gaggcgctcgacaagaagaagatctcgatggagcagatcgtcacgccgagcgaagcggtg
cgccgcgtcggccgcgacgaatcgcgcatgttcatcgaggcgaacaagccggtatcggtg
cacgatctcgtatacgggatgatcatccagtcgggcaacgacgccgcgatcgcgctggcc
gaactcgtcggcggcagcgaagggcagttcgtcacgatgatgaacgacgaggcggcgcgc
ctcggcatgaagggcacgcacttcgccgacgtgaacggcatgcccgacccgaaccactac
acgacggccggcgacctcgcgaagctgtccgcgcacctgatccgcgattttccgcagtac
tacagcatcttctcggagaaggaattcaagtacaacaacatccgccagggcaaccgcaat
cgcctgctgtggctggatccgacggtcgacggcctgaagacgggccacacgcaagcggcc
ggctactgcctgatcgcatcggccaagcgcgcgatcccgggtgtcgacagccagcgccgg
ctcgtgtcggtgatgatgggcgagcagaaggaaggcgagcgcacgcaggacagcatgaag
atgctgaactacggctatagcgcgttcgacgcggtgcgcctgttcaagggcggccaggcg
atgtcgacgccgcgcatctacaagggcaaggaaaacaccgtgcaggtcggcgtgaagggc
gaccagtgggtgaccgtgccgcgcggcctgggcgacaaggtcaagccggaagtcgaggtc
aacgcgccgctgatcgcgccgctcgcggagggccagcaggtcggtaccgtgaagatcgtc
gccgacggcaagacgctgtcggagttcccggttgtcgcgctgcaggcggtgccggaagcg
ggtatcttcgggcgtatctgggactcgattctgctgatgttcagcaagaagaagtaa

DBGET integrated database retrieval system