KEGG   Burkholderia diffusa: WI26_14190Help
Entry
WI26_14190        CDS       T04698                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bdf  Burkholderia diffusa
Pathway
bdf00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bdf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    WI26_14190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bdf02000]
    WI26_14190
Enzymes [BR:bdf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     WI26_14190
Transporters [BR:bdf02000]
 Other Transporters
  Pores ion channels [TC:1]
   WI26_14190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AOI58676
UniProt: A0A1B4BVI3
LinkDB All DBs
Position
1:3089445..3090059
Genome map
AA seq 204 aa AA seqDB search
MKLYYWPKTRAFRALWMLEEIGAVYELVPIDLRSHEQGSDAFVQVNPMAKLPALDDGSEP
FAESGAVLLYLADRCPGAGLGIAPDDPLRGRFLQWMFFTPSCLEPAMAEKFTGASGNPVA
FGWGNISRVQRALAQTLAHSRWLVGDHFTAADLLLASTLKIAFDAHLLPHEGVLGDYVAR
AEDRDGHRRAVAVEQREAARLLHA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactactggccgaaaacccgggcattccgggcgctgtggatgctggaggaa
atcggcgccgtctacgagctcgtgccgatcgacctgcgttctcacgaacagggcagcgac
gcgttcgtccaggtcaatccgatggccaagctgcccgcgctcgacgacggcagcgaaccg
ttcgccgaatccggcgccgtgctgctctatctcgccgatcgctgcccgggcgccgggctc
ggcatcgcgccggacgatccgctgcgcggccgcttcctgcaatggatgttcttcacgccc
agctgcctcgaacccgcgatggccgagaaattcaccggtgcgtcgggcaatccggtcgcc
ttcggctggggcaacatctcgcgtgtgcagcgtgcgctcgcgcaaacgctcgcccacagc
cgctggctggtcggcgatcacttcaccgcggccgacctgctgctcgccagcacgctcaag
atcgcgttcgacgcgcatttgctgccgcacgaaggcgtgcttggcgattatgtcgcacgg
gccgaggatcgcgacggccatcgccgcgcggtcgcggtcgaacagcgggaagcggcgcgt
ctgctgcatgcgtga

DBGET integrated database retrieval system